DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and C2

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_038512.2 Gene:C2 / 12263 MGIID:88226 Length:760 Species:Mus musculus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:110/272 - (40%) Gaps:66/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIP-SDWELTGVRLGEW 202
            :..|.:.:...||....   ||.:.:  .|.||||:.::|||||||...|. .|..|..|.:|: 
Mouse   475 MSANASDQERTPWQVTF---KPKSKE--TCQGSLISDQWVLTAAHCFHDIQMEDHHLWRVNVGD- 533

  Fly   203 DASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQY-------PGNSRDQLNDIALLRLRDEVQY 260
                 |....||           ::.||:.|..|.:       .|.|....:|||||:|..:|:.
Mouse   534 -----PTSQHGK-----------EFLVEDVIIAPGFNVHAKRKQGISEFYADDIALLKLSRKVKM 582

  Fly   261 SDFILPVCLP--------------TLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVP 311
            |....|:|||              :....|....|.::.|.|.:.....|     :|...|.|.|
Mouse   583 STHARPICLPCTVGANMALRRSPGSTCKDHETELLSQQKVPAHFVALNGN-----RLNINLRTGP 642

  Fly   312 T-SECNQRYATQR----------RTVTTKQMCAGGVEGVDS-CRGDSGGPLLLEDYSNGNSNYYI 364
            . :.|.|..:..:          ..||.:.:|:|..|..|: |:|:|||.:.|    .....::.
Mouse   643 EWTRCIQAVSQNKNIFPSLTNVSEVVTDQFLCSGMEEEDDNPCKGESGGAVFL----GRRYRFFQ 703

  Fly   365 AGVVSYGP-TPC 375
            .|:||:|. .||
Mouse   704 VGLVSWGLFDPC 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 72/272 (26%)
Tryp_SPc 138..397 CDD:238113 72/272 (26%)
C2NP_038512.2 CCP 94..149 CDD:153056
CCP 156..210 CDD:214478
vWFA 260..457 CDD:294047
MIDAS-like motif. /evidence=ECO:0000250 267..271
Tryp_SPc 480..750 CDD:238113 71/267 (27%)
Tryp_SPc 480..721 CDD:214473 71/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7585
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.