DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG42694

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:298 Identity:69/298 - (23%)
Similarity:111/298 - (37%) Gaps:94/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CGENFGDRVVGGNETTKREFP---WMALIEYTKPGNVKGHH--CGGSLINHRYVLTAAHCVSAIP 189
            ||....::.:     ||...|   |:|.|.       .|.|  |.||||:.::||:||.|:    
  Fly    27 CGAPISNQSI-----TKLRQPQAGWLAHIS-------NGTHVLCSGSLISKQFVLSAAQCI---- 75

  Fly   190 SDWELTG---VRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQL-NDIA 250
               ::.|   |:||..:|:.:|..                |.|...:    .|.:|..:| .||.
  Fly    76 ---DVHGKLFVQLGVSNATKSPHW----------------YTVSNVV----IPSHSGKRLQRDIG 117

  Fly   251 LLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSEC 315
            ||:|...|.|:||:.|:|:....:..:.:.:.:....:.|.....|..:.:     |..:....|
  Fly   118 LLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNPQTIV-----LSQLSRDRC 177

  Fly   316 NQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLL----------------LEDYSNGNSNYYI 364
            ....:   ..||.|::||..::..:||..|||..|.                :..|.||.|    
  Fly   178 KLNLS---GNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRS---- 235

  Fly   365 AGVVSYGPTPCGLKGW---PGVYTRVEAYLNWIENNVR 399
                           |   |.:|..|...:.|||..|:
  Fly   236 ---------------WCSEPAIYIDVAECVGWIETVVQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 63/284 (22%)
Tryp_SPc 138..397 CDD:238113 66/286 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 63/270 (23%)
Tryp_SPc 46..253 CDD:214473 60/267 (22%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.