DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:299 Identity:101/299 - (33%)
Similarity:148/299 - (49%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 QPTQTTKPTKRSGTKLLPMAPNCGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGS 171
            ||||:              .|.||: ....::|||...:...:||.|.:.  :.|:   |.||||
Zfish    21 QPTQS--------------PPACGKAPLNTKIVGGTNASAGSWPWQASLH--ESGS---HFCGGS 66

  Fly   172 LINHRYVLTAAHCVSAIPSDWELTGVRLGEWDAS-TNPDCTVGKNGRRDCNEPYVDYPVEERIPH 235
            ||:.:::|:||||..:.|:..:.| |.||..... .||            ||  |...|.:.|.|
Zfish    67 LISDQWILSAAHCFPSNPNPSDYT-VYLGRQSQDLPNP------------NE--VSKSVSQVIVH 116

  Fly   236 PQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNF--- 297
            |.|.|::.|  ||:|||.|...|.:|::|.||||    :...:.|....:.:.|||..|:..   
Zfish   117 PLYQGSTHD--NDMALLHLSSPVTFSNYIQPVCL----AADGSTFYNDTMWITGWGTIESGVSLP 175

  Fly   298 TSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVE-GVDSCRGDSGGPLLLEDYSNGNSN 361
            :..|..:..:..|..:.||..|. ...::|...||||.:: |.|||:||||||::::.:    :.
Zfish   176 SPQILQEVNVPIVGNNLCNCLYG-GGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSF----NT 235

  Fly   362 YYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNVRA 400
            :..|||||:| ..|....:||||.||..|.|||...|||
Zfish   236 WVQAGVVSFG-KGCADPNYPGVYARVSQYQNWISQYVRA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 89/261 (34%)
Tryp_SPc 138..397 CDD:238113 91/263 (35%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 89/261 (34%)
Tryp_SPc 38..269 CDD:238113 91/262 (35%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.