DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl11 and nep-4

DIOPT Version :9

Sequence 1:NP_649449.1 Gene:Nepl11 / 40540 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_509156.2 Gene:nep-4 / 183746 WormBaseID:WBGene00016896 Length:437 Species:Caenorhabditis elegans


Alignment Length:336 Identity:66/336 - (19%)
Similarity:103/336 - (30%) Gaps:76/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LEPYLDTSKQPCQDFYGYVCSHSA--NLSETGRQRFQSLLKET--DVAQLMDMELQLINFFKS-- 93
            ||..:|....||.|||.:.|...:  ::.:...|..:..|..:  ...|..:.::..|||.:|  
 Worm    27 LEKIVDWKSDPCDDFYRHACPVGSIEDIIKVSMQPLKDALNHSWKQKGQRNEGKVYNINFRRSHI 91

  Fly    94 -CESGRGVEALKGSQLYR-------QSGGWPSL----EPNKVNASQRTNQTQRWLGLLGYFHEVG 146
             |.....:..:.....||       ..|....|    |.|..:.....:|....:..||......
 Worm    92 CCHFFCKLLFIYYDYQYRFINYVTFYDGMLQPLYYHVEANVTDGINEIHQMMEDMVELGNIWLEK 156

  Fly   147 APYFFETSVTMQ-SNKRLVVLQPDGTRR------NTLRKFEQRVGEVLQSF-GIEQSRAHVTALE 203
            .|:....::|.: .|....:..|....:      |.|...|......:..| ||:.:........
 Worm   157 TPWVINNNLTEEMKNITNAIKMPVSLTKYTNFIYNLLSPIETDFLNCVSEFEGIQNNTLFCLFYS 221

  Fly   204 VLSLERSRRDIVKAD---HVEDQVQFSYGNFKRIVFGNASLIRLDWDG----------------- 248
            .....|:|......|   :.|..:.|.:.|:....:||....:|.:.|                 
 Worm   222 AKIFVRTRGSYFIDDNGYNAEGTIYFGFPNYYHTTYGNWRASKLGYTGTRVGHEIGHTFIEHSIN 286

  Fly   249 -----YFRKLLGGKTPQASDTIVVKQLPRLVEYF------ALLQNTSMVRLLNWIWTDYLMDIVD 302
                 ||.|       .|.|.:..:.|....||:      |.  |||          ||..|...
 Worm   287 PDGLPYFSK-------PAEDCVQNQYLKTCNEYYEGEVPDAC--NTS----------DYTFDDNG 332

  Fly   303 ADCHQLSETYA 313
            ||...|...||
 Worm   333 ADVFGLQLAYA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 63/326 (19%)
nep-4NP_509156.2 GluZincin 250..425 CDD:387391 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.