DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and FANK1

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_011538650.1 Gene:FANK1 / 92565 HGNCID:23527 Length:381 Species:Homo sapiens


Alignment Length:364 Identity:90/364 - (24%)
Similarity:141/364 - (38%) Gaps:92/364 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PDFVSRISNPTVNSVQLHWSLLKNASVYCIDKFHKRLG----WLQLDWTSSSP------------ 78
            |..|.::   |.:|::|:|.|.|.|         ||.|    |.:.......|            
Human    24 PPVVGKV---THHSIELYWDLEKKA---------KRQGPQEQWFRFSIEEEDPKMHTYGIIYTGY 76

  Fly    79 ---ITVTNLEENFGYRLRIKALTVSKDGHC-YVPL--------AISPEIVAC------------- 118
               ..|..||....||.|:|  ..|..|.| |.||        ::|..:|..             
Human    77 ATKHVVEGLEPRTLYRFRLK--VTSPSGECEYSPLVSVSTTRPSLSKSLVKIRMVTSVLHGPPTE 139

  Fly   119 -TAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAG 182
             |...:.|.| |.||:....:.|:.|:|:.....::.|...||..|..|..:|...::.:|:|.|
Human   140 NTGEPISSEH-LHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNG 203

  Fly   183 CSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALE 247
            ..|::.: |||:..|.||.|.|||...:.|....|..:|.|..|.|..|.|.|.....::::.::
Human   204 TDVNLKN-GSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIK 267

  Fly   248 AGANAEARDV-CGWTLLMR---------------------------------AVVMNASMELIKV 278
            .|...:..|. .|||.|||                                 ..|:|...||:::
Human   268 DGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQL 332

  Fly   279 LVTHGADLAALDGVGKTCTDLAKLYHRQEAKDYFDEVQK 317
            |:..|||.:..:..||...::|:::.||......:|.:|
Human   333 LLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 19/81 (23%)
ANK 128..244 CDD:238125 35/115 (30%)
ANK repeat 128..156 CDD:293786 6/27 (22%)
Ank_2 129..223 CDD:289560 29/93 (31%)
ANK repeat 158..189 CDD:293786 9/30 (30%)
ANK repeat 192..223 CDD:293786 12/30 (40%)
ANK 193..311 CDD:238125 38/151 (25%)
Ank_2 197..290 CDD:289560 32/126 (25%)
ANK repeat 225..256 CDD:293786 6/30 (20%)
ANK repeat 258..290 CDD:293786 14/64 (22%)
FANK1XP_011538650.1 FN3 19..103 CDD:214495 22/92 (24%)
Ank_2 150..243 CDD:315466 29/93 (31%)
ANK repeat 150..177 CDD:293786 6/26 (23%)
ANK repeat 179..210 CDD:293786 9/30 (30%)
ANK 207..334 CDD:238125 31/127 (24%)
ANK repeat 212..243 CDD:293786 12/30 (40%)
ANK repeat 245..311 CDD:293786 13/65 (20%)
ANK 308..>366 CDD:238125 13/57 (23%)
ANK repeat 313..344 CDD:293786 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BKQB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50214
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.