DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and AKRP

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_569027.2 Gene:AKRP / 836737 AraportID:AT5G66055 Length:435 Species:Arabidopsis thaliana


Alignment Length:296 Identity:72/296 - (24%)
Similarity:119/296 - (40%) Gaps:62/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELDDKLTQEEYKL--LWP-----------------DFVSRISNPT--VNSVQLHWSLLKN----- 53
            :|:|.||.:|.||  |.|                 |..:.:|:|:  |......|::...     
plant   151 DLNDFLTYKEAKLAQLRPVILDKPGNFSDDSGASSDGETAVSSPSERVAPKNPRWAVYGKGFDHV 215

  Fly    54 ASVYCIDKFHKRLGWLQLDWTSSSPITVTNLEENFGYRLRIKALTVSKDGHCYVPLAISPEIVAC 118
            |..:..||:...      |..|..|..:.:.||.|....|                  :|::...
plant   216 AKFFNSDKYDPS------DKKSDGPRKLLSKEEKFMLNSR------------------NPDLAVA 256

  Fly   119 TAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASN--GFLPLANAIIQGEMCIIDLLLSA 181
            |:......|.|:..   |:.:||..:|:..   ::..|::  |...|..|||..:..|.:.||..
plant   257 TSKKWLPLHTLAAC---GEFYLVDSLLKHN---LDINATDVGGLTVLHRAIIGKKQAITNYLLRE 315

  Fly   182 GCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFAL 246
            ..:..:.| ..|.|.:|.|......|:.::||...|.:.|.|.:|.||.|.||.|.:.:|||..|
plant   316 SANPFVLD-DEGATLMHYAVQTASAPTIKLLLLYNADINAQDRDGWTPLHVAVQARRSDIVKLLL 379

  Fly   247 EAGANAEARDVCGWTLLMRAVVMNASM---ELIKVL 279
            ..||:.|.::..|.|.|...:.:...:   |::|:|
plant   380 IKGADIEVKNKDGLTPLGLCLYLGREIRTYEVMKLL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 14/69 (20%)
ANK 128..244 CDD:238125 34/117 (29%)
ANK repeat 128..156 CDD:293786 5/27 (19%)
Ank_2 129..223 CDD:289560 24/95 (25%)
ANK repeat 158..189 CDD:293786 8/32 (25%)
ANK repeat 192..223 CDD:293786 9/30 (30%)
ANK 193..311 CDD:238125 30/90 (33%)
Ank_2 197..290 CDD:289560 28/86 (33%)
ANK repeat 225..256 CDD:293786 14/30 (47%)
ANK repeat 258..290 CDD:293786 6/25 (24%)
AKRPNP_569027.2 PHA02876 <190..>412 CDD:165207 60/252 (24%)
ANK repeat 261..290 CDD:293786 7/34 (21%)
ANK repeat 293..323 CDD:293786 8/29 (28%)
Ank_2 297..389 CDD:403870 32/92 (35%)
ANK repeat 325..356 CDD:293786 9/30 (30%)
ANK repeat 358..389 CDD:293786 14/30 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.