DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and PIA1

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_568184.1	Gene:	PIA1 / 830677	AraportID:	AT5G07840	Length:	175	Species:	Arabidopsis thaliana

Alignment Length:	142	Identity:	46/142 - (32%)
Similarity:	61/142 - (42%)	Gaps:	20/142 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   151 LMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNK 215
            |.|.|.:..|.|  |:..:..|           ...:.....|.|.||:....|.|.:.:.||::
plant     2 LQEQPVALSFRP--NSFRRRSM-----------ETGVDRDDRGWTQLHIKAREGDLKAVKELLDQ 53

  Fly   216 KARLEA----TDSNGMTPAHCAVDANQLEIVKFALEAGANAEAR--DVCGWTLLMRAVVMNASME 274
            .|.:.|    ..|.||||.|.|.....:|::...||.|||.|||  ..||||.| .|.......|
plant    54 GADVNALACGPKSKGMTPLHLAAKGGHIEVMDLLLERGANMEARTSGACGWTPL-HAAAKERKRE 117

  Fly   275 LIKVLVTHGADL 286
            .:|.||.:||.|
plant   118 AVKFLVGNGAFL 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	25/96 (26%)
		ANK repeat	128..156	CDD:293786	2/4 (50%)
		Ank_2	129..223	CDD:289560	17/75 (23%)
		ANK repeat	158..189	CDD:293786	4/30 (13%)
		ANK repeat	192..223	CDD:293786	10/34 (29%)
		ANK	193..311	CDD:238125	39/100 (39%)
		Ank_2	197..290	CDD:289560	37/96 (39%)
		ANK repeat	225..256	CDD:293786	15/32 (47%)
		ANK repeat	258..290	CDD:293786	13/29 (45%)
PIA1	NP_568184.1	ANK repeat	30..61	CDD:293786	10/30 (33%)
		Ank_2	35..127	CDD:403870	34/92 (37%)
		ANK repeat	63..98	CDD:293786	15/34 (44%)
		ANK repeat	100..127	CDD:293786	10/27 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010