DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and AT4G19150

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_193650.2 Gene:AT4G19150 / 827653 AraportID:AT4G19150 Length:243 Species:Arabidopsis thaliana


Alignment Length:174 Identity:49/174 - (28%)
Similarity:82/174 - (47%) Gaps:7/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LANAIIQGEMCIIDLLLSAG-CSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNG 226
            |.:|...|::..:..::|:. .:|:..|..| |||||||.:.||......|...||.:.|...:.
plant    20 LHSAARSGDLAAVQSIISSNPLAVNSRDKHS-RTPLHLAAWAGHNEVVSYLCKNKADVGAAAGDD 83

  Fly   227 MTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDG 291
            |...|.|.....||:|:..|.||.:.::....|.|.|..| ...:..|::|.||..||.:.|...
plant    84 MGAIHFASQKGHLEVVRTLLSAGGSVKSITRKGLTPLHYA-AQGSHFEIVKYLVKKGASVRATTK 147

  Fly   292 VGKTCTDLAKLYHRQEAKDYFDEVQKFRLEKSVATADAVTAITR 335
            .||:..|:|   ...|.:::.:|.:: :..|:....:..|.|.:
plant   148 AGKSPADVA---GNAETQNFLEECEE-QARKAKVNNEKKTEIVK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 26/81 (32%)
ANK repeat 128..156 CDD:293786
Ank_2 129..223 CDD:289560 20/60 (33%)
ANK repeat 158..189 CDD:293786 5/26 (19%)
ANK repeat 192..223 CDD:293786 14/30 (47%)
ANK 193..311 CDD:238125 38/117 (32%)
Ank_2 197..290 CDD:289560 30/92 (33%)
ANK repeat 225..256 CDD:293786 9/30 (30%)
ANK repeat 258..290 CDD:293786 11/31 (35%)
AT4G19150NP_193650.2 Ank_4 20..69 CDD:290365 16/49 (33%)
ANK repeat 20..47 CDD:293786 5/26 (19%)
ANK 44..156 CDD:238125 38/113 (34%)
ANK repeat 49..80 CDD:293786 14/31 (45%)
Ank_2 54..145 CDD:289560 29/91 (32%)
ANK repeat 82..113 CDD:293786 9/30 (30%)
ANK repeat 115..144 CDD:293786 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.