DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Ankrd36

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_076305.2 Gene:Ankrd36 / 76389 MGIID:1923639 Length:1415 Species:Mus musculus


Alignment Length:194 Identity:50/194 - (25%)
Similarity:78/194 - (40%) Gaps:37/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VKRML-----------RRRPSLMEYPASNGFLPLANAII-----------------------QGE 171
            |::||           |::.:.:.|..::|...:.:.::                       |.|
Mouse    49 VQKMLEFGDIDVNVTDRKKRTALHYACAHGQSEMVSLLLWYDCNIEARDREESTALIKATQRQHE 113

  Fly   172 MCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDA 236
            :| :.:||..|...:..|... .|.||...|......|..||...|..|....||.||...||..
Mouse   114 IC-VKILLENGADSNAVDIHQ-NTSLHYTVYNKDTTIAAKLLAFNADTEVKTKNGYTPLILAVLE 176

  Fly   237 NQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDLA 300
            |:.|:|:..|:|.||..|.|.|..:.|:.| |...|..:|.:|:..||:.:.:|..|.|....|
Mouse   177 NKQEMVELLLQAAANINALDNCKRSALIHA-VRTQSKNMISLLLQQGANASLVDIYGATAQSYA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 31/136 (23%)
ANK repeat 128..156 CDD:293786 5/25 (20%)
Ank_2 129..223 CDD:289560 22/115 (19%)
ANK repeat 158..189 CDD:293786 7/53 (13%)
ANK repeat 192..223 CDD:293786 9/30 (30%)
ANK 193..311 CDD:238125 37/108 (34%)
Ank_2 197..290 CDD:289560 32/92 (35%)
ANK repeat 225..256 CDD:293786 14/30 (47%)
ANK repeat 258..290 CDD:293786 9/31 (29%)
Ankrd36NP_076305.2 Ank_2 37..130 CDD:289560 12/81 (15%)
ANK repeat 37..64 CDD:293786 3/14 (21%)
ANK 61..186 CDD:238125 28/126 (22%)
ANK repeat 68..97 CDD:293786 2/28 (7%)
ANK repeat 99..130 CDD:293786 6/31 (19%)
ANK repeat 132..163 CDD:293786 9/31 (29%)
Ank_2 137..229 CDD:289560 32/92 (35%)
ANK 162..>240 CDD:238125 28/79 (35%)
ANK repeat 165..196 CDD:293786 14/30 (47%)
ANK repeat 198..229 CDD:293786 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.