DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Potegl

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_081911.1 Gene:Potegl / 70981 MGIID:1918231 Length:382 Species:Mus musculus


Alignment Length:298 Identity:77/298 - (25%)
Similarity:120/298 - (40%) Gaps:46/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TNLEEN-FGY---RLRIKALTVSKDGHCYVPLAISPE----IVACTAAALP-----------STH 127
            ||.||. .|:   :.|...|:..::...|:.:|..|:    :.|| |..||           ..:
Mouse    28 TNREETPLGFCDIKARRSNLSFGREDPAYLDMAYFPDNDLHMAAC-AGDLPFVRLYFTLGKYEVN 91

  Fly   128 CLSRAIRKGQQFL-------VKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSV 185
            ...|..|....|.       :...|.||...:....::...||..|:...|..|:..||....::
Mouse    92 HRDRENRNAMHFACFYGHLELVIYLWRRGCEINVCDNHNITPLMKAVQSWEDKIVCFLLEHHANL 156

  Fly   186 HIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGA 250
            ||.| ..|.|.||.|.|.|:|.:|..||...|.:|....:.:||...|:..|:|::.:|.:...|
Mouse   157 HIKD-SMGNTALHYAVYSGNLATAARLLQYGADIEERTKDNLTPLLLALRENRLKMAQFLVRMEA 220

  Fly   251 NAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTC------------TDLAKLY 303
            :..|.|......||.||..::.: ::.:::..|.|:...|..|.|.            |.|.:|.
Mouse   221 SVHAVDSQRRNSLMYAVRCDSPV-MVNLILQQGVDINLKDLFGWTALRYAIEGDRDVRTMLLELR 284

  Fly   304 HRQEAKDYFDEVQKFRLEKSVATADA-VTAITRYTKEV 340
            .|..|.. ..|....||   :..||| ||:.|...|.:
Mouse   285 KRNRAFQ-SSENSSIRL---INKADAEVTSPTANEKVI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 6/19 (32%)
ANK 128..244 CDD:238125 34/122 (28%)
ANK repeat 128..156 CDD:293786 6/34 (18%)
Ank_2 129..223 CDD:289560 29/100 (29%)
ANK repeat 158..189 CDD:293786 9/30 (30%)
ANK repeat 192..223 CDD:293786 13/30 (43%)
ANK 193..311 CDD:238125 36/129 (28%)
Ank_2 197..290 CDD:289560 26/92 (28%)
ANK repeat 225..256 CDD:293786 8/30 (27%)
ANK repeat 258..290 CDD:293786 6/31 (19%)
PoteglNP_081911.1 Ank_4 67..116 CDD:290365 8/49 (16%)
ANK 91..216 CDD:238125 35/125 (28%)
ANK repeat 96..127 CDD:293786 5/30 (17%)
Ank_2 102..192 CDD:289560 27/90 (30%)
ANK repeat 132..160 CDD:293786 9/27 (33%)
ANK 158..281 CDD:238125 34/124 (27%)
ANK repeat 162..193 CDD:293786 13/30 (43%)
Ank_2 167..259 CDD:289560 26/92 (28%)
ANK repeat 195..226 CDD:293786 8/30 (27%)
ANK repeat 228..259 CDD:293786 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.