DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Poteg

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_011240461.1 Gene:Poteg / 70952 MGIID:1918202 Length:1339 Species:Mus musculus


Alignment Length:184 Identity:51/184 - (27%)
Similarity:80/184 - (43%) Gaps:26/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PSLMEYPASNGFLPLAN---AIIQGEMCIIDLLLSAG-CSVHIGDPGSGRTPLHLAFYYGHLPSA 209
            |:..:|..:  :.||.:   ...:|:...:::||:.| |:|:..| ...||.||.|..||.||..
Mouse    36 PNYPKYHTT--YRPLGHIHRVAAEGDAARMEILLTLGQCNVYHRD-RKDRTALHFACVYGRLPVV 97

  Fly   210 RILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASME 274
            .||:.....::|.|.|..||...:|...:.:.....||.||:...||..|.:.|..| |.|...|
Mouse    98 TILVKNNCEIDALDKNHTTPLMKSVQCWKQKCATVLLEHGADPNIRDSSGNSALHYA-VYNGHQE 161

  Fly   275 LIKVLVTHGADLAALDGVGKTCTDLAKLYHRQEAKDYFDEVQKFRLEKSVATAD 328
            :..:|:.:.||:                  .|:.||.|..:.....||.|..|:
Mouse   162 MASLLLQYNADI------------------EQKTKDGFTPLLLALREKRVEVAE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 28/98 (29%)
ANK repeat 128..156 CDD:293786 2/6 (33%)
Ank_2 129..223 CDD:289560 23/77 (30%)
ANK repeat 158..189 CDD:293786 8/34 (24%)
ANK repeat 192..223 CDD:293786 12/30 (40%)
ANK 193..311 CDD:238125 34/117 (29%)
Ank_2 197..290 CDD:289560 30/92 (33%)
ANK repeat 225..256 CDD:293786 8/30 (27%)
ANK repeat 258..290 CDD:293786 9/31 (29%)
PotegXP_011240461.1 ANK repeat 51..78 CDD:293786 6/26 (23%)
ANK repeat 82..111 CDD:293786 12/28 (43%)
Ank_2 85..176 CDD:372319 30/109 (28%)
ANKYR 89..281 CDD:223738 35/128 (27%)
ANK repeat 116..144 CDD:293786 7/27 (26%)
ANK repeat 146..177 CDD:293786 10/49 (20%)
ANK repeat 179..210 CDD:293786 6/19 (32%)
ANK repeat 212..243 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.