DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and LOC691519

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_017445696.1 Gene:LOC691519 / 691519 RGDID:1582795 Length:1085 Species:Rattus norvegicus


Alignment Length:236 Identity:60/236 - (25%)
Similarity:101/236 - (42%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LSRAIRKGQQFLVKRML----------RRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGC 183
            :.:|.|.|....|:::|          :::.:.:....:.|...:..|:::|: |.::...|..|
  Rat    52 IHKAARDGDAARVQQLLLGKHCVNDKDKKKRTALHIACAYGHPKVVMALVEGK-CEVNATDSEEC 115

  Fly   184 SVHI------------------GDP----GSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNG 226
            :..:                  .||    ..|.:.||.|.||.:...|..||:.:..:|||:.:|
  Rat   116 TSLVKAVQCQEEECATILLENNADPNIVDAQGNSALHYAVYYKNTSLAAKLLDHEVNIEATNKDG 180

  Fly   227 MTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDG 291
            .||...||..|:|:|.||.|...|:..|.|....|.||.| |.:.|..|::.::..|.||...|.
  Rat   181 FTPFLLAVSENKLKIAKFLLMKNASIHAADNQKRTALMHA-VSHDSTNLVRFVLEQGVDLFVKDA 244

  Fly   292 VGKTCTDLA---------KLYHRQEAKDYFDEVQKFRLEKS 323
            .|.|..|.|         ::....:||.|.:..:...:|||
  Rat   245 FGLTAIDYAADFKYNSNMEILLEYKAKRYEESERANLVEKS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 33/146 (23%)
ANK repeat 128..156 CDD:293786 5/36 (14%)
Ank_2 129..223 CDD:289560 24/125 (19%)
ANK repeat 158..189 CDD:293786 6/48 (13%)
ANK repeat 192..223 CDD:293786 11/30 (37%)
ANK 193..311 CDD:238125 43/126 (34%)
Ank_2 197..290 CDD:289560 35/92 (38%)
ANK repeat 225..256 CDD:293786 13/30 (43%)
ANK repeat 258..290 CDD:293786 10/31 (32%)
LOC691519XP_017445696.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.