DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and Ppp1r27

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_081090.1	Gene:	Ppp1r27 / 68701	MGIID:	1915951	Length:	154	Species:	Mus musculus

Alignment Length:	138	Identity:	36/138 - (26%)
Similarity:	65/138 - (47%)	Gaps:	2/138 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   106 YVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQG 170
            |.|......::|..:...|:.......||:|....|.|.:|.|...::....:|...|..|::.|
Mouse    11 YSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRARKVSLDTIHPSGLAALHEAVLSG 75

  Fly   171 EMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVD 235
            .:..:.||:..|..:|..|. :|.||||:|...|:...||.|::..|..:|.:.:|..|:. .:|
Mouse    76 NLECVKLLVKYGADIHQRDE-TGWTPLHIACSDGYPDIARYLISLGADRDAANDDGDLPSD-LID 138

  Fly   236 ANQLEIVK 243
            .:..::|:
Mouse   139 PDFKDLVE 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	32/116 (28%)
		ANK repeat	128..156	CDD:293786	7/27 (26%)
		Ank_2	129..223	CDD:289560	28/93 (30%)
		ANK repeat	158..189	CDD:293786	8/30 (27%)
		ANK repeat	192..223	CDD:293786	12/30 (40%)
		ANK	193..311	CDD:238125	16/51 (31%)
		Ank_2	197..290	CDD:289560	13/47 (28%)
		ANK repeat	225..256	CDD:293786	4/19 (21%)
		ANK repeat	258..290	CDD:293786
Ppp1r27	NP_081090.1	ANK	38..147	CDD:238125	32/111 (29%)
		Ank_2	38..127	CDD:289560	28/89 (31%)
		ANK repeat	63..94	CDD:293786	8/30 (27%)
		ANK 1	63..92		7/28 (25%)
		ANK repeat	96..127	CDD:293786	12/30 (40%)
		ANK 2	96..125		11/28 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010