DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and LOC685184

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_038962268.1 Gene:LOC685184 / 685184 RGDID:1597699 Length:2594 Species:Rattus norvegicus


Alignment Length:315 Identity:83/315 - (26%)
Similarity:119/315 - (37%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FHKR----LGWLQ-LDWTSSSPITVTNLEENFGYRLRIKALTVSKDGHCYVPLAISPEIVACTAA 121
            |||:    ||:.. ||          |:...||          |||.....|    |:..|..|.
  Rat     5 FHKKQRTPLGFCDGLD----------NVFVGFG----------SKDEKGCRP----PKYHASYAP 45

  Fly   122 ALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSV- 185
            ..|    :.:|...|....||..:.|....||.........|..|.:.|...::.||:.:.|.: 
  Rat    46 YYP----IHKAASMGDVNTVKSFVERGVFAMEQTDWKYRTALHFACVYGHPEVVTLLVESSCEIS 106

  Fly   186 ---------------------------HIGDPG----SGRTPLHLAFYYGHLPSARILLNKKARL 219
                                       |..||.    |..|.||.|.|.|.:.:|..||..||.:
  Rat   107 PKDIKDATPLIKASQCRQTECLNILLKHGADPNIMDCSDNTALHYAVYNGDIETATKLLEYKANI 171

  Fly   220 EATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGA 284
            ||.:.|.:||...|:..|:.::.:|.:..||||:..|..|.:.||.||...:.: :||:|:....
  Rat   172 EAINENKITPLLLALKQNKEKMAEFLIHNGANAKTCDFLGRSSLMYAVRCGSEL-IIKLLLQRDI 235

  Fly   285 DLAALDGVGKTCTDLAKLYHRQEAK--------DYFDEVQKFRLEKSVATADAVT 331
            |....|..|.|    ||.| ..|:|        ||.:|..:.|..: :...||.|
  Rat   236 DTFKQDVFGWT----AKRY-AVESKSRVRKLLIDYDEEELRQRCSE-ITRKDACT 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 10/40 (25%)
ANK 128..244 CDD:238125 35/147 (24%)
ANK repeat 128..156 CDD:293786 7/27 (26%)
Ank_2 129..223 CDD:289560 30/125 (24%)
ANK repeat 158..189 CDD:293786 7/58 (12%)
ANK repeat 192..223 CDD:293786 14/30 (47%)
ANK 193..311 CDD:238125 41/125 (33%)
Ank_2 197..290 CDD:289560 32/92 (35%)
ANK repeat 225..256 CDD:293786 10/30 (33%)
ANK repeat 258..290 CDD:293786 9/31 (29%)
LOC685184XP_038962268.1 Ank_2 41..>265 CDD:423045 61/233 (26%)
ANK repeat 48..73 CDD:293786 6/28 (21%)
ANK repeat 80..109 CDD:293786 6/28 (21%)
ANK repeat 114..142 CDD:293786 3/27 (11%)
ANK repeat 144..175 CDD:293786 14/30 (47%)
ANK repeat 177..202 CDD:293786 6/24 (25%)
ANK repeat 210..241 CDD:293786 9/31 (29%)
PTZ00121 <268..745 CDD:173412 5/18 (28%)
PTZ00121 <1793..2105 CDD:173412
DUF3496 1976..2058 CDD:403277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.