Sequence 1: | NP_001097672.1 | Gene: | CG9766 / 40539 | FlyBaseID: | FBgn0037229 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001365522.1 | Gene: | Potea / 67575 | MGIID: | 1914825 | Length: | 2320 | Species: | Mus musculus |
Alignment Length: | 278 | Identity: | 63/278 - (22%) |
---|---|---|---|
Similarity: | 108/278 - (38%) | Gaps: | 67/278 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 94 IKALTVSKDGHCYVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASN 158
Fly 159 GFLPLANAIIQGEMCIIDLLLSAGCSV----------------------------HIGDPG---- 191
Fly 192 SGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARD 256
Fly 257 VCGWTLLMRAVVMNASMELIKVLVTHGADL------------AALDGVGKTCTDLAKLYH---RQ 306
Fly 307 EAKDYFDEVQKFRLEKSV 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9766 | NP_001097672.1 | FN3 | 35..98 | CDD:214495 | 1/3 (33%) |
ANK | 128..244 | CDD:238125 | 31/147 (21%) | ||
ANK repeat | 128..156 | CDD:293786 | 6/27 (22%) | ||
Ank_2 | 129..223 | CDD:289560 | 25/125 (20%) | ||
ANK repeat | 158..189 | CDD:293786 | 7/58 (12%) | ||
ANK repeat | 192..223 | CDD:293786 | 10/30 (33%) | ||
ANK | 193..311 | CDD:238125 | 34/132 (26%) | ||
Ank_2 | 197..290 | CDD:289560 | 27/104 (26%) | ||
ANK repeat | 225..256 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 258..290 | CDD:293786 | 7/43 (16%) | ||
Potea | NP_001365522.1 | ANK repeat | 49..76 | CDD:293786 | 7/31 (23%) |
Ank_2 | 65..>252 | CDD:423045 | 41/199 (21%) | ||
ANK repeat | 80..109 | CDD:293786 | 7/40 (18%) | ||
ANK repeat | 114..142 | CDD:293786 | 3/27 (11%) | ||
ANK repeat | 144..175 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 177..208 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 210..235 | CDD:293786 | 4/25 (16%) | ||
Smc | <1772..1994 | CDD:224117 | |||
DUF3496 | 1956..2060 | CDD:403277 | |||
DUF3496 | 2181..2284 | CDD:403277 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1514637at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |