DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Potea

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001365522.1 Gene:Potea / 67575 MGIID:1914825 Length:2320 Species:Mus musculus


Alignment Length:278 Identity:63/278 - (22%)
Similarity:108/278 - (38%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IKALTVSKDGHCYVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASN 158
            :|:::|..:.. |.||....:     ||:...|..|.|.|..|:..:..|..:.|.:        
Mouse    32 MKSISVPNEPR-YKPLRKIHQ-----AASDGDTERLQRMISLGKHSVHDRDFKERTA-------- 82

  Fly   159 GFLPLANAIIQGEMCIIDLLLSAGCSV----------------------------HIGDPG---- 191
                |..|...|::.::.:||...|.:                            |..||.    
Mouse    83 ----LHFACACGQVEVVSILLRNNCDIDAADMNFITPLMKAVQNWTYECVCILLKHGADPNRKDK 143

  Fly   192 SGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARD 256
            :|.|.||.|....:...|:.||...|.:|..:.:|.||...|:..|::|:.||.::.|||....|
Mouse   144 NGNTSLHYAVSEDNQTLAKCLLKYSANMEQKNKDGFTPLLLALKENKIEMAKFLVKMGANIHVFD 208

  Fly   257 VCGWTLLMRAVVMNASMELIKVLVTHGADL------------AALDGVGKTCTDLAKLYH---RQ 306
            ......|:.|:..: |.:::.:|:..|.|.            .|::|..|...::...|.   |:
Mouse   209 DMRRNTLLYAIRWD-SKDMVNLLLDEGIDFFFRDVFGWTALRYAIEGTSKGSREILMNYDEMLRR 272

  Fly   307 EAKDYFDEVQKFRLEKSV 324
            :.||...| .||..:||:
Mouse   273 KNKDGIPE-YKFFEDKSL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 1/3 (33%)
ANK 128..244 CDD:238125 31/147 (21%)
ANK repeat 128..156 CDD:293786 6/27 (22%)
Ank_2 129..223 CDD:289560 25/125 (20%)
ANK repeat 158..189 CDD:293786 7/58 (12%)
ANK repeat 192..223 CDD:293786 10/30 (33%)
ANK 193..311 CDD:238125 34/132 (26%)
Ank_2 197..290 CDD:289560 27/104 (26%)
ANK repeat 225..256 CDD:293786 11/30 (37%)
ANK repeat 258..290 CDD:293786 7/43 (16%)
PoteaNP_001365522.1 ANK repeat 49..76 CDD:293786 7/31 (23%)
Ank_2 65..>252 CDD:423045 41/199 (21%)
ANK repeat 80..109 CDD:293786 7/40 (18%)
ANK repeat 114..142 CDD:293786 3/27 (11%)
ANK repeat 144..175 CDD:293786 10/30 (33%)
ANK repeat 177..208 CDD:293786 11/30 (37%)
ANK repeat 210..235 CDD:293786 4/25 (16%)
Smc <1772..1994 CDD:224117
DUF3496 1956..2060 CDD:403277
DUF3496 2181..2284 CDD:403277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.