DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and Ankrd2

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_064417.2	Gene:	Ankrd2 / 56642	MGIID:	1861447	Length:	332	Species:	Mus musculus

Alignment Length:	144	Identity:	53/144 - (36%)
Similarity:	76/144 - (52%)	Gaps:	8/144 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   163 LANAIIQGEMCIIDLLLSAGCSVHIGDPGSGR---TPLHLAFYYGHLPSARILLNKKARLEATDS 224
            |..|.::|.|.|::.||..|.:|...|    |   |.:|.|...|||...|:|.::.|.....|.
Mouse   158 LHRASLEGHMEILEKLLENGATVDFQD----RLDCTAMHWACRGGHLEVVRLLQSRGADTNVRDK 218

  Fly   225 NGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAAL 289
            ...||.|.||....:|||:..|..|.:..|:|..|.:.|..||.:| ..::||:|:.||||:.|.
Mouse   219 LLSTPLHVAVRTGHVEIVEHFLSLGLDINAKDREGDSALHDAVRLN-RYKIIKLLLLHGADMMAK 282

  Fly   290 DGVGKTCTDLAKLY 303
            :..|||.|||.:|:
Mouse   283 NLAGKTPTDLVQLW 296

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	29/83 (35%)
		ANK repeat	128..156	CDD:293786
		Ank_2	129..223	CDD:289560	20/62 (32%)
		ANK repeat	158..189	CDD:293786	9/25 (36%)
		ANK repeat	192..223	CDD:293786	10/33 (30%)
		ANK	193..311	CDD:238125	43/114 (38%)
		Ank_2	197..290	CDD:289560	34/92 (37%)
		ANK repeat	225..256	CDD:293786	11/30 (37%)
		ANK repeat	258..290	CDD:293786	13/31 (42%)
Ankrd2	NP_064417.2	ANK	148..273	CDD:238125	40/119 (34%)
		ANK repeat	155..184	CDD:293786	9/25 (36%)
		ANK repeat	188..217	CDD:293786	9/28 (32%)
		ANK repeat	219..250	CDD:293786	11/30 (37%)
		ANK repeat	252..283	CDD:293786	13/31 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010