DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and ankrd1b

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001095858.1 Gene:ankrd1b / 564159 ZFINID:ZDB-GENE-070820-13 Length:283 Species:Danio rerio


Alignment Length:189 Identity:63/189 - (33%)
Similarity:86/189 - (45%) Gaps:16/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 FLVKRMLRRRPSLMEYPASNGFLP----------LANAIIQGEMCIIDLLLSAGCSVHIGDPGSG 193
            ||...:..:.|.:..|.| .|..|          |..|..||.:.|::.||.||.|:...|....
Zfish    96 FLKAALDNKLPMIKSYLA-RGADPNACDNFNRTALHRACSQGNVEIVNALLEAGASMGNKDKLQA 159

  Fly   194 RTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVC 258
             |.:|.|...|.||....|||..|:|:|.|....|..|.||.....|..:..:..||:..|:|:.
Zfish   160 -TEVHWACRGGSLPVLEALLNHGAKLDARDKLRSTALHVAVKTGHYECAEHLIHCGADVNAKDIE 223

  Fly   259 GWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDLAKLYHRQE-AKDYFDEVQ 316
            |.|.|..||.:| ..:||::|:.||.||...:..||:..|  |:...|. ||..||..|
Zfish   224 GDTPLHDAVSLN-RFKLIQLLLLHGGDLHIKNFEGKSPMD--KVCEWQNGAKSIFDNFQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 36/114 (32%)
ANK repeat 128..156 CDD:293786 4/16 (25%)
Ank_2 129..223 CDD:289560 30/93 (32%)
ANK repeat 158..189 CDD:293786 12/40 (30%)
ANK repeat 192..223 CDD:293786 12/30 (40%)
ANK 193..311 CDD:238125 42/118 (36%)
Ank_2 197..290 CDD:289560 34/92 (37%)
ANK repeat 225..256 CDD:293786 8/30 (27%)
ANK repeat 258..290 CDD:293786 13/31 (42%)
ankrd1bNP_001095858.1 Ank_4 98..145 CDD:290365 10/47 (21%)
ANK 119..241 CDD:238125 40/123 (33%)
ANK repeat 126..155 CDD:293786 10/28 (36%)
Ank_2 129..221 CDD:289560 32/92 (35%)
ANK repeat 157..188 CDD:293786 12/31 (39%)
ANK repeat 190..221 CDD:293786 8/30 (27%)
Ank_5 210..262 CDD:290568 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.