DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and ANKRD7

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_062618.2	Gene:	ANKRD7 / 56311	HGNCID:	18588	Length:	254	Species:	Homo sapiens

Alignment Length:	139	Identity:	44/139 - (31%)
Similarity:	69/139 - (49%)	Gaps:	2/139 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   162 PLANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNG 226
            ||..|...|...::..|:...|.:::.| ...::||..|....:...|.||||..|..:..|...
Human    62 PLHLACANGHTDVVLFLIEQQCKINVRD-SENKSPLIKAVQCQNEDCATILLNFGADPDLRDIRY 125

  Fly   227 MTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDG 291
            .|..|.||....|.:|:..||..|:.||::..|:|.|:.||: |.:.:::|.|:..|||:.|.|.
Human   126 NTVLHYAVCGQSLSLVEKLLEYEADLEAKNKDGYTPLLVAVI-NNNPKMVKFLLEKGADVNASDN 189

  Fly   292 VGKTCTDLA 300
            ..:|...||
Human   190 YQRTALILA 198

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	23/81 (28%)
		ANK repeat	128..156	CDD:293786
		Ank_2	129..223	CDD:289560	16/60 (27%)
		ANK repeat	158..189	CDD:293786	6/26 (23%)
		ANK repeat	192..223	CDD:293786	9/30 (30%)
		ANK	193..311	CDD:238125	37/108 (34%)
		Ank_2	197..290	CDD:289560	32/92 (35%)
		ANK repeat	225..256	CDD:293786	11/30 (37%)
		ANK repeat	258..290	CDD:293786	12/31 (39%)
ANKRD7	NP_062618.2	ANK repeat	29..56	CDD:293786
		ANK	53..178	CDD:238125	35/117 (30%)
		ANK 1	58..87		6/24 (25%)
		ANK repeat	60..122	CDD:293786	16/60 (27%)
		ANK 2	91..120		9/28 (32%)
		ANK repeat	124..155	CDD:293786	11/30 (37%)
		ANK 3	124..153		9/28 (32%)
		ANK repeat	157..188	CDD:293786	12/31 (39%)
		ANK 4	157..186		11/29 (38%)
		Ank_4	158..211	CDD:316185	16/42 (38%)
		ANK 5	190..219		3/9 (33%)
		ANK repeat	190..214	CDD:293786	3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010