DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and ANKRD30BL

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001345345.1 Gene:ANKRD30BL / 554226 HGNCID:35167 Length:258 Species:Homo sapiens


Alignment Length:189 Identity:49/189 - (25%)
Similarity:85/189 - (44%) Gaps:11/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LSRAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSG 193
            :.:|..:||.:.::||:::....:....:.....|..|...|...::.||:...|.:.:.| |..
Human    42 IHKAASRGQAWKLERMMKKTTMDLNIRDAKKRTALYWACANGHAEVVTLLVDRKCQLDVLD-GEN 105

  Fly   194 RTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVC 258
            ||.|..|........|.||::..|.....|..|.|..|.||::..|.:|...|..||:.|.::..
Human   106 RTILMKALQCQREACANILIDSGADPNIVDVYGNTAVHYAVNSENLSVVAKLLSCGADIEVKNKA 170

  Fly   259 GWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDLAKLYHRQEAKDYFDEVQK 317
            |.|.|:.| :...|.|:::.|:|..|:..|:|..        |..| |:..:|..::.|
Human   171 GHTPLLLA-IRKRSEEIVEFLLTKNANANAVDKF--------KCVH-QQLLEYKQKISK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 29/114 (25%)
ANK repeat 128..156 CDD:293786 5/26 (19%)
Ank_2 129..223 CDD:289560 21/93 (23%)
ANK repeat 158..189 CDD:293786 6/30 (20%)
ANK repeat 192..223 CDD:293786 8/30 (27%)
ANK 193..311 CDD:238125 34/117 (29%)
Ank_2 197..290 CDD:289560 28/92 (30%)
ANK repeat 225..256 CDD:293786 11/30 (37%)
ANK repeat 258..290 CDD:293786 10/31 (32%)
ANKRD30BLNP_001345345.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ANK repeat 42..69 CDD:293786 5/26 (19%)
ANK 66..191 CDD:238125 34/126 (27%)
ANK repeat 71..102 CDD:293786 6/30 (20%)
ANK 1 71..100 6/28 (21%)
ANK repeat 104..135 CDD:293786 8/30 (27%)
ANK 2 104..133 8/28 (29%)
ANK repeat 137..168 CDD:293786 11/30 (37%)
ANK 3 137..166 10/28 (36%)
ANK repeat 170..201 CDD:293786 10/31 (32%)
ANK 4 170..199 9/29 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..258 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.