DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and psmd10

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_001016356.1	Gene:	psmd10 / 549110	XenbaseID:	XB-GENE-946051	Length:	227	Species:	Xenopus tropicalis

Alignment Length:	141	Identity:	48/141 - (34%)
Similarity:	68/141 - (48%)	Gaps:	3/141 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   170 GEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAV 234
            |...:.:.||..|..|...| .:|.||||:|...|.....|.|:.|.|::.|.:..|.||.|.|.
Frog    52 GRTEVAEYLLRLGVPVDAKD-DAGWTPLHIAASAGRDDIVRALIGKGAQVNAANQIGCTPLHYAA 115

  Fly   235 DANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDL 299
            ..|:.||....||.||:.:|:|....|.|.|| ....::.::::|:.|.|.....|..|.|...|
Frog   116 SKNKHEIALMLLENGASPDAKDNLESTPLHRA-ASKGNLRIVQILLKHQASTNIQDTEGNTPLHL 179

  Fly   300 AKLYHR-QEAK 309
            |....| :|||
Frog   180 ACDEERVEEAK 190

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	26/73 (36%)
		ANK repeat	128..156	CDD:293786
		Ank_2	129..223	CDD:289560	18/52 (35%)
		ANK repeat	158..189	CDD:293786	5/18 (28%)
		ANK repeat	192..223	CDD:293786	12/30 (40%)
		ANK	193..311	CDD:238125	42/118 (36%)
		Ank_2	197..290	CDD:289560	30/92 (33%)
		ANK repeat	225..256	CDD:293786	13/30 (43%)
		ANK repeat	258..290	CDD:293786	7/31 (23%)
psmd10	NP_001016356.1	PTZ00322	9..>95	CDD:140343	15/43 (35%)
		ANK repeat	40..71	CDD:293786	5/18 (28%)
		Ank_2	<54..>213	CDD:393464	47/139 (34%)
		ANK repeat	73..104	CDD:293786	12/30 (40%)
		ANK repeat	107..137	CDD:293786	13/29 (45%)
		ANK repeat	139..170	CDD:293786	7/31 (23%)
		ANK repeat	172..203	CDD:293786	8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010