DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and Psmd10

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_058579.2	Gene:	Psmd10 / 53380	MGIID:	1858898	Length:	231	Species:	Mus musculus

Alignment Length:	141	Identity:	48/141 - (34%)
Similarity:	70/141 - (49%)	Gaps:	3/141 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   170 GEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAV 234
            |...|::.||..|..|:..| .:|.:|||:|...|.....:.||.|.|.:.|.:.||.||.|.|.
Mouse    51 GHTEIVEFLLQLGVPVNDKD-DAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAA 114

  Fly   235 DANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDL 299
            ..|:.||....||.|||.:|:|....|.:.||.. ..:::::.:|:.:.|.....|..|.|...|
Mouse   115 SKNRHEIAVMLLEGGANPDAKDHYDATAMHRAAA-KGNLKMVHILLFYKASTNIQDTEGNTPLHL 178

  Fly   300 AKLYHR-QEAK 309
            |....| :|||
Mouse   179 ACDEERVEEAK 189

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	27/73 (37%)
		ANK repeat	128..156	CDD:293786
		Ank_2	129..223	CDD:289560	18/52 (35%)
		ANK repeat	158..189	CDD:293786	6/18 (33%)
		ANK repeat	192..223	CDD:293786	11/30 (37%)
		ANK	193..311	CDD:238125	41/118 (35%)
		Ank_2	197..290	CDD:289560	30/92 (33%)
		ANK repeat	225..256	CDD:293786	15/30 (50%)
		ANK repeat	258..290	CDD:293786	5/31 (16%)
Psmd10	NP_058579.2	ANK 1	3..36
		Ank_4	10..60	CDD:290365	2/8 (25%)
		ANK	36..159	CDD:238125	37/109 (34%)
		ANK 2	37..69		6/17 (35%)
		ANK repeat	39..70	CDD:293786	6/18 (33%)
		Ank_2	44..136	CDD:289560	33/85 (39%)
		ANK 3	70..102		11/32 (34%)
		ANK repeat	72..103	CDD:293786	11/30 (37%)
		ANK 4	103..135		14/31 (45%)
		ANK repeat	105..136	CDD:293786	15/30 (50%)
		Ank_2	110..202	CDD:289560	26/81 (32%)
		ANK 5	136..168		6/32 (19%)
		ANK repeat	138..169	CDD:293786	5/31 (16%)
		ANK 6	169..201		9/21 (43%)
		Ank	171..203	CDD:278452	8/19 (42%)
		ANK repeat	171..202	CDD:293786	8/19 (42%)
		ANK 7	202..226
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010