| Sequence 1: | NP_001097672.1 | Gene: | CG9766 / 40539 | FlyBaseID: | FBgn0037229 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001131143.1 | Gene: | POTEC / 388468 | HGNCID: | 33894 | Length: | 542 | Species: | Homo sapiens |
| Alignment Length: | 195 | Identity: | 52/195 - (26%) |
|---|---|---|---|
| Similarity: | 85/195 - (43%) | Gaps: | 6/195 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 129 LSRAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSG 193
Fly 194 RTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVC 258
Fly 259 GWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDLAKLYHRQ---EAKDYFDEVQKFRL 320
Fly 321 320 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9766 | NP_001097672.1 | FN3 | 35..98 | CDD:214495 | |
| ANK | 128..244 | CDD:238125 | 30/114 (26%) | ||
| ANK repeat | 128..156 | CDD:293786 | 8/26 (31%) | ||
| Ank_2 | 129..223 | CDD:289560 | 25/93 (27%) | ||
| ANK repeat | 158..189 | CDD:293786 | 6/30 (20%) | ||
| ANK repeat | 192..223 | CDD:293786 | 10/30 (33%) | ||
| ANK | 193..311 | CDD:238125 | 35/120 (29%) | ||
| Ank_2 | 197..290 | CDD:289560 | 27/92 (29%) | ||
| ANK repeat | 225..256 | CDD:293786 | 10/30 (33%) | ||
| ANK repeat | 258..290 | CDD:293786 | 8/31 (26%) | ||
| POTEC | NP_001131143.1 | ANK 1 | 138..171 | ||
| Ank_4 | 143..193 | CDD:290365 | 4/15 (27%) | ||
| ANK | 167..292 | CDD:238125 | 32/116 (28%) | ||
| ANK 2 | 172..201 | 8/23 (35%) | |||
| ANK repeat | 174..203 | CDD:293786 | 8/25 (32%) | ||
| Ank_2 | 177..269 | CDD:289560 | 25/93 (27%) | ||
| ANK repeat | 205..236 | CDD:293786 | 6/31 (19%) | ||
| ANK 3 | 205..234 | 5/29 (17%) | |||
| ANK | 233..357 | CDD:238125 | 37/125 (30%) | ||
| ANK repeat | 238..269 | CDD:293786 | 10/30 (33%) | ||
| ANK 4 | 238..267 | 9/28 (32%) | |||
| Ank_2 | 243..335 | CDD:289560 | 27/92 (29%) | ||
| ANK repeat | 271..302 | CDD:293786 | 10/30 (33%) | ||
| ANK 5 | 271..300 | 9/28 (32%) | |||
| ANK repeat | 304..335 | CDD:293786 | 8/31 (26%) | ||
| ANK 6 | 304..333 | 8/29 (28%) | |||
| ANK 7 | 337..373 | 7/32 (22%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 369..494 | 52/195 (27%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1514637at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||