| Sequence 1: | NP_001097672.1 | Gene: | CG9766 / 40539 | FlyBaseID: | FBgn0037229 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_345259.5 | Gene: | Ankrd35 / 365881 | RGDID: | 1305527 | Length: | 990 | Species: | Rattus norvegicus |
| Alignment Length: | 200 | Identity: | 50/200 - (25%) |
|---|---|---|---|
| Similarity: | 81/200 - (40%) | Gaps: | 39/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 129 LSRAIRKGQQFLVKRMLRR---RPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHI-GD 189
Fly 190 PGS-------------------------------GRTPLHLAFYYGHLPSARILLNKKARLEATD 223
Fly 224 SNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAA 288
Fly 289 LDGVG 293 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9766 | NP_001097672.1 | FN3 | 35..98 | CDD:214495 | |
| ANK | 128..244 | CDD:238125 | 34/149 (23%) | ||
| ANK repeat | 128..156 | CDD:293786 | 7/29 (24%) | ||
| Ank_2 | 129..223 | CDD:289560 | 28/128 (22%) | ||
| ANK repeat | 158..189 | CDD:293786 | 8/31 (26%) | ||
| ANK repeat | 192..223 | CDD:293786 | 11/61 (18%) | ||
| ANK | 193..311 | CDD:238125 | 31/100 (31%) | ||
| Ank_2 | 197..290 | CDD:289560 | 28/92 (30%) | ||
| ANK repeat | 225..256 | CDD:293786 | 8/30 (27%) | ||
| ANK repeat | 258..290 | CDD:293786 | 10/31 (32%) | ||
| Ankrd35 | XP_345259.5 | ANK | <24..107 | CDD:238125 | 18/85 (21%) |
| ANK repeat | 24..51 | CDD:293786 | 7/26 (27%) | ||
| ANK repeat | 53..84 | CDD:293786 | 8/30 (27%) | ||
| Ank_2 | 58..150 | CDD:289560 | 17/91 (19%) | ||
| ANK | 81..206 | CDD:238125 | 26/125 (21%) | ||
| ANK repeat | 86..117 | CDD:293786 | 2/30 (7%) | ||
| ANK repeat | 119..150 | CDD:293786 | 10/30 (33%) | ||
| Ank_2 | 124..216 | CDD:289560 | 28/92 (30%) | ||
| ANK repeat | 152..183 | CDD:293786 | 8/30 (27%) | ||
| ANK repeat | 185..216 | CDD:293786 | 10/31 (32%) | ||
| Ank_2 | 190..>250 | CDD:289560 | 11/30 (37%) | ||
| KASH_CCD | 740..952 | CDD:291334 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1514637at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||