DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Ankrd23

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001101681.1 Gene:Ankrd23 / 316330 RGDID:1310398 Length:306 Species:Rattus norvegicus


Alignment Length:248 Identity:68/248 - (27%)
Similarity:111/248 - (44%) Gaps:28/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QLDWTSSSPITVTNLE--ENFGYRLRIKALTVSKDGHCYVPLAISPEIVACTAAALPSTHCLSRA 132
            :|:..:||.:|:.||.  ||...|.|.|     :..|...|.  .||     :.|.|........
  Rat    58 KLERFNSSRLTLDNLTDLENLIQRRRKK-----RQRHKVPPR--EPE-----SGAEPQPQVPLEP 110

  Fly   133 IRKGQQFLVKRMLRRRPSLMEYPASNGFLPLAN----------AIIQGEMCIIDLLLSAGCSVHI 187
            :  |.:..:|.....:.:|::...::|..|.|:          |.::|...:::.||:||.::..
  Rat   111 V--GLEMFLKAAAENQEALIDKYLADGGDPNAHDKLHRTALHWACLKGHRQLVNKLLAAGAAIET 173

  Fly   188 GDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANA 252
            .|. ..|||:..|...|||...:.|||:.|::.|.|....||.|.||.....:.::..:|.||:.
  Rat   174 RDL-LDRTPVFWACRGGHLDILKQLLNQGAQINAQDKIWSTPLHVAVRMGHSDCLEHLIECGAHI 237

  Fly   253 EARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDLAKLYHR 305
            .|:|..|.|.|..| |.....:..|:|:.:||.|...:|...|...||:.:.|
  Rat   238 NAQDKEGDTALHEA-VRYGHHKATKLLLLYGAKLGMKNGASLTPVQLARDWQR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 11/29 (38%)
ANK 128..244 CDD:238125 31/125 (25%)
ANK repeat 128..156 CDD:293786 3/27 (11%)
Ank_2 129..223 CDD:289560 25/103 (24%)
ANK repeat 158..189 CDD:293786 9/40 (23%)
ANK repeat 192..223 CDD:293786 12/30 (40%)
ANK 193..311 CDD:238125 38/113 (34%)
Ank_2 197..290 CDD:289560 30/92 (33%)
ANK repeat 225..256 CDD:293786 9/30 (30%)
ANK repeat 258..290 CDD:293786 10/31 (32%)
Ankrd23NP_001101681.1 Ank_4 118..165 CDD:290365 7/46 (15%)
ANK 139..264 CDD:238125 37/126 (29%)
ANK repeat 146..175 CDD:293786 6/28 (21%)
Ank_2 149..241 CDD:289560 29/92 (32%)
ANK repeat 179..208 CDD:293786 12/28 (43%)
ANK repeat 210..241 CDD:293786 9/30 (30%)
Ank_5 230..284 CDD:290568 17/54 (31%)
ANK repeat 243..274 CDD:293786 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.