DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Fank1

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001008348.1 Gene:Fank1 / 309071 RGDID:1304756 Length:344 Species:Rattus norvegicus


Alignment Length:347 Identity:87/347 - (25%)
Similarity:139/347 - (40%) Gaps:72/347 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PDFVSRISNPTVNSVQLHWSLLKNASVYCIDKFHKRLG----WLQLDWTSSSP------------ 78
            |..|.::   |.:|::|:|.|         :|..||.|    ||:.......|            
  Rat    14 PPVVGKV---THHSIELYWDL---------EKREKRQGPQEQWLRFSIEEEDPKMHNYGVIYTGY 66

  Fly    79 ---ITVTNLEENFGYRLRIKALTVSKDGHCYVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFL 140
               ..|..||....||.|:|..:.|.: :.|.|:.    .||.|...:.|.| ..||:....:.|
  Rat    67 ATKHVVEGLEPRTLYRFRLKVTSPSGE-YEYSPVV----SVATTREPISSEH-FHRAVNVNDEDL 125

  Fly   141 VKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGH 205
            :.|:|.....:::.|...||..|..|..:|...::.:|:|.|..|::.: |||:..|.||.|.||
  Rat   126 LLRILEGGHVMVDVPNKFGFTALMVAAQKGYTRLVKILISNGTDVNLKN-GSGKDSLMLACYAGH 189

  Fly   206 LPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDV-CGWTLLMR---- 265
            |...:.|....|..:|.|..|.|..|.|.|.....::.:.::.|...:..|. .|||.|||    
  Rat   190 LDVVKYLRKHGASWDARDLGGCTALHWAADGGHCPVIDWMIKDGCEVDVVDTGSGWTPLMRVSAV 254

  Fly   266 -----------------------------AVVMNASMELIKVLVTHGADLAALDGVGKTCTDLAK 301
                                         ..|:|...:|:::|:..|||....:..||...::|:
  Rat   255 TGSQKVASLLIEAGADVNVRDKDGKTPLMVAVLNNHEQLVQLLLDKGADATVKNEFGKGVLEMAR 319

  Fly   302 LYHRQEAKDYFDEVQKFRLEKS 323
            ::.||......:|.:|....||
  Rat   320 VFDRQNVLSLLEERKKKMPRKS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 19/81 (23%)
ANK 128..244 CDD:238125 34/115 (30%)
ANK repeat 128..156 CDD:293786 5/27 (19%)
Ank_2 129..223 CDD:289560 28/93 (30%)
ANK repeat 158..189 CDD:293786 9/30 (30%)
ANK repeat 192..223 CDD:293786 12/30 (40%)
ANK 193..311 CDD:238125 37/151 (25%)
Ank_2 197..290 CDD:289560 31/126 (25%)
ANK repeat 225..256 CDD:293786 6/30 (20%)
ANK repeat 258..290 CDD:293786 13/64 (20%)
Fank1NP_001008348.1 FN3 12..104 CDD:238020 25/106 (24%)
ANK 1 109..139 7/30 (23%)
ANK repeat 114..141 CDD:293786 5/26 (19%)
ANK repeat 143..174 CDD:293786 9/30 (30%)
ANK 2 143..172 9/28 (32%)
Ank_2 148..240 CDD:403870 27/92 (29%)
ANK repeat 176..207 CDD:293786 12/30 (40%)
ANK 3 176..205 11/28 (39%)
ANK repeat 209..275 CDD:293786 13/65 (20%)
ANK 4 209..238 6/28 (21%)
Ank_2 214..308 CDD:403870 18/93 (19%)
ANK 5 243..273 6/29 (21%)
ANK repeat 277..308 CDD:293786 7/30 (23%)
ANK 6 277..306 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50214
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.