DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Ankrd30a

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_038962390.1 Gene:Ankrd30a / 295999 RGDID:1309783 Length:2375 Species:Rattus norvegicus


Alignment Length:262 Identity:62/262 - (23%)
Similarity:113/262 - (43%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IKALTVSKDGHCYVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASN 158
            :|:::|..:.. |.||....:     ||:...|..|.:.|..|:..:..|..::|.:| .:..:.
  Rat    32 MKSISVPNEPR-YKPLRKIHQ-----AASEGDTERLQKMISLGKHSVHDRDFKQRTAL-HFACAY 89

  Fly   159 GFLPLANAIIQGEMCIIDL--------LLSA--------GCSV--HIGDPG----SGRTPLHLAF 201
            |.:.:.:.:::.. |.||.        |:.|        .|::  |..||.    :|.|.||.|.
  Rat    90 GHVEVVSVLLRNN-CDIDAADRNSITPLMKAVQNWTYECVCTLLKHGADPNRMDKNGNTSLHYAV 153

  Fly   202 YYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRA 266
            ...:...|:.||...|.||..:.:|.||...|:..|::|:.||.::.|||....|......|:.|
  Rat   154 SEDNQTLAKCLLKYSANLEQKNKDGFTPLLLALKENKIEMAKFLVKKGANIHVFDEMKRNTLLYA 218

  Fly   267 VVMNASMELIKVLVTHGADL------------AALDGVGKTCTDLAKLYH---RQEAKDYFDEVQ 316
            :..: |.:::.:|:..|.|.            .|::|..|...::...|.   |::.|:...|.:
  Rat   219 IRWD-SKDMVNLLLDEGIDFFFKDVFGWTALRYAIEGTSKGSREILMNYDEKLRRKNKNGIPEYK 282

  Fly   317 KF 318
            ||
  Rat   283 KF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 1/3 (33%)
ANK 128..244 CDD:238125 33/137 (24%)
ANK repeat 128..156 CDD:293786 6/27 (22%)
Ank_2 129..223 CDD:289560 27/115 (23%)
ANK repeat 158..189 CDD:293786 8/48 (17%)
ANK repeat 192..223 CDD:293786 11/30 (37%)
ANK 193..311 CDD:238125 35/132 (27%)
Ank_2 197..290 CDD:289560 28/104 (27%)
ANK repeat 225..256 CDD:293786 11/30 (37%)
ANK repeat 258..290 CDD:293786 7/43 (16%)
Ankrd30aXP_038962390.1 ANK repeat 49..76 CDD:293786 6/31 (19%)
Ank_2 63..>278 CDD:423045 50/217 (23%)
ANK repeat 80..109 CDD:293786 6/30 (20%)
ANK repeat 111..142 CDD:293786 6/30 (20%)
ANK repeat 144..175 CDD:293786 11/30 (37%)
ANK repeat 177..208 CDD:293786 11/30 (37%)
ANK repeat 210..235 CDD:293786 4/25 (16%)
SbcC <1824..>2075 CDD:223496
DUF3496 2011..2115 CDD:403277
DUF3496 2236..2324 CDD:403277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.