DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Ppp1r27

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001099328.1 Gene:Ppp1r27 / 287881 RGDID:1308861 Length:154 Species:Rattus norvegicus


Alignment Length:140 Identity:39/140 - (27%)
Similarity:68/140 - (48%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLME--YPASNGFLPLANAII 168
            |.|......::|..:...|:.......||:|....|.|.:|.|...::  ||  :|...|..|::
  Rat    11 YSPRQRRRRLLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRARKVSLDTIYP--SGLAALHEAVL 73

  Fly   169 QGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCA 233
            .|.:..:.||:..|..:|..|. :|.||||:|...|:...||.|::..|..:||:.:|..|:. .
  Rat    74 SGNLECVKLLVKYGADIHQRDE-TGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSD-L 136

  Fly   234 VDANQLEIVK 243
            :|.:..::|:
  Rat   137 IDPDFKDLVE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 35/118 (30%)
ANK repeat 128..156 CDD:293786 8/29 (28%)
Ank_2 129..223 CDD:289560 30/95 (32%)
ANK repeat 158..189 CDD:293786 8/30 (27%)
ANK repeat 192..223 CDD:293786 12/30 (40%)
ANK 193..311 CDD:238125 17/51 (33%)
Ank_2 197..290 CDD:289560 14/47 (30%)
ANK repeat 225..256 CDD:293786 4/19 (21%)
ANK repeat 258..290 CDD:293786
Ppp1r27NP_001099328.1 ANK 38..147 CDD:238125 35/113 (31%)
Ank_2 38..127 CDD:289560 30/91 (33%)
ANK repeat 63..94 CDD:293786 8/30 (27%)
ANK repeat 96..127 CDD:293786 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.