DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and ANKRD2

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_001278147.1	Gene:	ANKRD2 / 26287	HGNCID:	495	Length:	446	Species:	Homo sapiens

Alignment Length:	144	Identity:	54/144 - (37%)
Similarity:	74/144 - (51%)	Gaps:	8/144 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   163 LANAIIQGEMCIIDLLLSAGCSVHIGDPGSGR---TPLHLAFYYGHLPSARILLNKKARLEATDS 224
            |..|.::|.|.|::.||..|.:|...|    |   |.:|.|...|||...::|.:..|.....|.
Human   271 LHRASLEGHMEILEKLLDNGATVDFQD----RLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDK 331

  Fly   225 NGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAAL 289
            ...||.|.||...|:|||:..|..|....|||..|.|.|..||.:| ..::||:|:.||||:...
Human   332 LLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLN-RYKIIKLLLLHGADMMTK 395

  Fly   290 DGVGKTCTDLAKLY 303
            :..|||.|||.:|:
Human   396 NLAGKTPTDLVQLW 409

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	29/83 (35%)
		ANK repeat	128..156	CDD:293786
		Ank_2	129..223	CDD:289560	19/62 (31%)
		ANK repeat	158..189	CDD:293786	9/25 (36%)
		ANK repeat	192..223	CDD:293786	9/33 (27%)
		ANK	193..311	CDD:238125	44/114 (39%)
		Ank_2	197..290	CDD:289560	35/92 (38%)
		ANK repeat	225..256	CDD:293786	12/30 (40%)
		ANK repeat	258..290	CDD:293786	13/31 (42%)
ANKRD2	NP_001278147.1	Ank_4	237..287	CDD:290365	5/15 (33%)
		ANK	261..386	CDD:238125	42/119 (35%)
		ANK repeat	268..297	CDD:293786	9/25 (36%)
		Ank_2	271..363	CDD:289560	32/95 (34%)
		ANK repeat	301..330	CDD:293786	8/28 (29%)
		ANK repeat	332..363	CDD:293786	12/30 (40%)
		Ank_2	337..>402	CDD:289560	27/65 (42%)
		ANK repeat	365..390	CDD:293786	10/25 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010