DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and ANKRD23

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_659431.5 Gene:ANKRD23 / 200539 HGNCID:24470 Length:305 Species:Homo sapiens


Alignment Length:185 Identity:55/185 - (29%)
Similarity:90/185 - (48%) Gaps:23/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLAN----------AIIQGEMCIIDLLLSAGCSV 185
            :|..:.|::|:.:.|           ::|..|.|:          |.::|...:::.||.||.:|
Human   117 KAAAENQEYLIDKYL-----------TDGGDPNAHDKLHRTALHWACLKGHSQLVNKLLVAGATV 170

  Fly   186 HIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGA 250
            ...|. ..|||:..|...|||...:.|||:.||:.|.|..|.||.|.||.....:.::..:|.||
Human   171 DARDL-LDRTPVFWACRGGHLVILKQLLNQGARVNARDKIGSTPLHVAVRTRHPDCLEHLIECGA 234

  Fly   251 NAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDLAKLYHR 305
            :..|:|..|.|.|..| |.:.|.:.:|:|:.:||:|...:....|...||:.:.|
Human   235 HLNAQDKEGDTALHEA-VRHGSYKAMKLLLLYGAELGVRNAASVTPVQLARDWQR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 35/122 (29%)
ANK repeat 128..156 CDD:293786 4/24 (17%)
Ank_2 129..223 CDD:289560 28/101 (28%)
ANK repeat 158..189 CDD:293786 10/40 (25%)
ANK repeat 192..223 CDD:293786 13/30 (43%)
ANK 193..311 CDD:238125 40/113 (35%)
Ank_2 197..290 CDD:289560 33/92 (36%)
ANK repeat 225..256 CDD:293786 10/30 (33%)
ANK repeat 258..290 CDD:293786 11/31 (35%)
ANKRD23NP_659431.5 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..104
ANK 138..263 CDD:238125 41/126 (33%)
ANK 1 143..172 7/28 (25%)
ANK repeat 145..174 CDD:293786 7/28 (25%)
ANK 2 176..205 12/28 (43%)
ANK repeat 178..207 CDD:293786 13/28 (46%)
Interaction with TTN. /evidence=ECO:0000269|PubMed:14583192 178..195 7/16 (44%)
ANK repeat 209..240 CDD:293786 10/30 (33%)
ANK 3 209..238 9/28 (32%)
PHA02917 <225..>303 CDD:332678 20/65 (31%)
ANK repeat 242..273 CDD:293786 11/31 (35%)
ANK 4 242..271 11/29 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.