Sequence 1: | NP_001097672.1 | Gene: | CG9766 / 40539 | FlyBaseID: | FBgn0037229 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_653299.4 | Gene: | ANKRD35 / 148741 | HGNCID: | 26323 | Length: | 1001 | Species: | Homo sapiens |
Alignment Length: | 222 | Identity: | 55/222 - (24%) |
---|---|---|---|
Similarity: | 85/222 - (38%) | Gaps: | 46/222 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 LSRAIRKGQQFLVKRMLRR---RPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHI-GD 189
Fly 190 PGS-------------------------------GRTPLHLAFYYGHLPSARILLNKKARLEATD 223
Fly 224 SNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAA 288
Fly 289 LDGVGKTC-------TDLAKLYHRQEA 308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9766 | NP_001097672.1 | FN3 | 35..98 | CDD:214495 | |
ANK | 128..244 | CDD:238125 | 34/149 (23%) | ||
ANK repeat | 128..156 | CDD:293786 | 7/29 (24%) | ||
Ank_2 | 129..223 | CDD:289560 | 28/128 (22%) | ||
ANK repeat | 158..189 | CDD:293786 | 8/31 (26%) | ||
ANK repeat | 192..223 | CDD:293786 | 11/61 (18%) | ||
ANK | 193..311 | CDD:238125 | 37/123 (30%) | ||
Ank_2 | 197..290 | CDD:289560 | 28/92 (30%) | ||
ANK repeat | 225..256 | CDD:293786 | 8/30 (27%) | ||
ANK repeat | 258..290 | CDD:293786 | 10/31 (32%) | ||
ANKRD35 | NP_653299.4 | ANK | <24..107 | CDD:238125 | 18/85 (21%) |
Ank_4 | 24..74 | CDD:290365 | 13/52 (25%) | ||
ANK repeat | 24..51 | CDD:293786 | 7/26 (27%) | ||
ANK repeat | 53..84 | CDD:293786 | 8/30 (27%) | ||
ANK 1 | 53..82 | 8/28 (29%) | |||
Ank_2 | 58..150 | CDD:289560 | 17/91 (19%) | ||
ANK | 81..206 | CDD:238125 | 26/125 (21%) | ||
ANK repeat | 86..117 | CDD:293786 | 2/30 (7%) | ||
ANK 2 | 86..115 | 2/28 (7%) | |||
ANK repeat | 119..150 | CDD:293786 | 10/30 (33%) | ||
ANK 3 | 119..148 | 10/28 (36%) | |||
Ank_2 | 124..216 | CDD:289560 | 28/92 (30%) | ||
ANK repeat | 152..183 | CDD:293786 | 8/30 (27%) | ||
ANK 4 | 152..181 | 8/28 (29%) | |||
ANK repeat | 185..216 | CDD:293786 | 10/31 (32%) | ||
ANK 5 | 185..214 | 9/29 (31%) | |||
ANK 6 | 218..247 | 6/24 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 256..296 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 352..482 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 559..599 | ||||
COG1340 | 676..968 | CDD:224259 | |||
PEARLI-4 | <803..950 | CDD:253129 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 879..902 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1514637at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |