DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and ANKRD35

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_653299.4 Gene:ANKRD35 / 148741 HGNCID:26323 Length:1001 Species:Homo sapiens


Alignment Length:222 Identity:55/222 - (24%)
Similarity:85/222 - (38%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LSRAIRKGQQFLVKRMLRR---RPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHI-GD 189
            |..|:.:|....|..:..|   ||:.::   |||..|...|..:|....:.:||:.|..::. .:
Human    24 LLEAVHRGDVGRVAALASRKSARPTKLD---SNGQSPFHLAASKGLTECLTILLANGADINSKNE 85

  Fly   190 PGS-------------------------------GRTPLHLAFYYGHLPSARILLNKKARLEATD 223
            .||                               .|:|||.|...|...|..:|.:.:|.|:..|
Human    86 DGSTALHLATISCQPQCVKVLLQHGANEDAVDAENRSPLHWAASSGCASSVLLLCDHEAFLDVLD 150

  Fly   224 SNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAA 288
            ::|.||...|.......|....|:.||.....|....:.|:.| ....|.|:.::|::||||..|
Human   151 NDGRTPLMIASLGGHAAICSQLLQRGARVNVTDKNDKSALILA-CEKGSAEVAELLLSHGADAGA 214

  Fly   289 LDGVGKTC-------TDLAKLYHRQEA 308
            :|..|...       .|.|...|.|:|
Human   215 VDSTGHDALHYALHTQDKALWRHLQQA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 34/149 (23%)
ANK repeat 128..156 CDD:293786 7/29 (24%)
Ank_2 129..223 CDD:289560 28/128 (22%)
ANK repeat 158..189 CDD:293786 8/31 (26%)
ANK repeat 192..223 CDD:293786 11/61 (18%)
ANK 193..311 CDD:238125 37/123 (30%)
Ank_2 197..290 CDD:289560 28/92 (30%)
ANK repeat 225..256 CDD:293786 8/30 (27%)
ANK repeat 258..290 CDD:293786 10/31 (32%)
ANKRD35NP_653299.4 ANK <24..107 CDD:238125 18/85 (21%)
Ank_4 24..74 CDD:290365 13/52 (25%)
ANK repeat 24..51 CDD:293786 7/26 (27%)
ANK repeat 53..84 CDD:293786 8/30 (27%)
ANK 1 53..82 8/28 (29%)
Ank_2 58..150 CDD:289560 17/91 (19%)
ANK 81..206 CDD:238125 26/125 (21%)
ANK repeat 86..117 CDD:293786 2/30 (7%)
ANK 2 86..115 2/28 (7%)
ANK repeat 119..150 CDD:293786 10/30 (33%)
ANK 3 119..148 10/28 (36%)
Ank_2 124..216 CDD:289560 28/92 (30%)
ANK repeat 152..183 CDD:293786 8/30 (27%)
ANK 4 152..181 8/28 (29%)
ANK repeat 185..216 CDD:293786 10/31 (32%)
ANK 5 185..214 9/29 (31%)
ANK 6 218..247 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..599
COG1340 676..968 CDD:224259
PEARLI-4 <803..950 CDD:253129
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 879..902
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.