DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and F40G9.17

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001379947.1 Gene:F40G9.17 / 13188172 WormBaseID:WBGene00185078 Length:240 Species:Caenorhabditis elegans


Alignment Length:184 Identity:54/184 - (29%)
Similarity:80/184 - (43%) Gaps:18/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 HCLSRAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDP- 190
            |.|:..:|:.:....||:|.|.|.|:.|...:|...:..|.:.|.:.::...:       :.|| 
 Worm    18 HELAELLREAKDDEAKRLLTRYPKLVGYTDDSGRSTIHFAAVGGSLPLLQFAI-------LNDPE 75

  Fly   191 ------GSGRTPLHLAFYYGHLPSARILLN-KKARLEATDSNGMTPAHCAVDANQLEIVKFALEA 248
                  ..|.|||.:|...|.:...|.||. ....::.|:||..|..|.|...|.:||||..:||
 Worm    76 MAHKTDDLGWTPLMIASSAGRVDVVRYLLTLPDVDVKHTNSNKQTSLHYACSKNHVEIVKLLIEA 140

  Fly   249 GAN-AEARDVCGWTLLMRAVVMNASMELIKVLVTHG-ADLAALDGVGKTCTDLA 300
            ..| ....|..|.|.|.||......: :::.||:.| ..|...||.|.|...||
 Worm   141 DPNIINLPDKFGATALHRAASRGNDV-IVRALVSTGKCSLDRQDGEGNTALHLA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 33/123 (27%)
ANK repeat 128..156 CDD:293786 9/27 (33%)
Ank_2 129..223 CDD:289560 23/101 (23%)
ANK repeat 158..189 CDD:293786 3/30 (10%)
ANK repeat 192..223 CDD:293786 9/31 (29%)
ANK 193..311 CDD:238125 39/111 (35%)
Ank_2 197..290 CDD:289560 30/95 (32%)
ANK repeat 225..256 CDD:293786 12/31 (39%)
ANK repeat 258..290 CDD:293786 9/32 (28%)
F40G9.17NP_001379947.1 ANK repeat 49..81 CDD:293786 5/38 (13%)
Ank_2 54..146 CDD:403870 27/98 (28%)
ANK repeat 84..115 CDD:293786 9/30 (30%)
ANK repeat 119..149 CDD:293786 11/29 (38%)
Ank_2 122..211 CDD:403870 26/73 (36%)
ANK repeat 151..183 CDD:293786 9/32 (28%)
ANK repeat 185..216 CDD:293786 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.