DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Asb7

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_536691.2 Gene:Asb7 / 117589 MGIID:2152835 Length:318 Species:Mus musculus


Alignment Length:187 Identity:49/187 - (26%)
Similarity:78/187 - (41%) Gaps:21/187 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 AAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCS 184
            :||.....|:...:..|....||.::            .||..|..|.:.|...|..|:|.:...
Mouse    54 SAARGKERCVRVFLEHGADPTVKDLI------------GGFTALHYAAMHGRARIARLMLESEYR 106

  Fly   185 VHI--GDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALE 247
            ..|  .....|.||||:|.:||.....|:||..||.::.....|.||...|:...:...||..|:
Mouse   107 SDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLD 171

  Fly   248 AGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGAD--LAALDGVGKTCTDLAKL 302
            ..||.:.::    ..|:|..|:.::....::.:..|||  |..|:. |:|...|:.|
Mouse   172 HNANIDIQN----GFLLRYAVIKSNHSYCRMFLQRGADTNLGRLED-GQTPLHLSAL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 31/117 (26%)
ANK repeat 128..156 CDD:293786 4/27 (15%)
Ank_2 129..223 CDD:289560 25/95 (26%)
ANK repeat 158..189 CDD:293786 9/32 (28%)
ANK repeat 192..223 CDD:293786 13/30 (43%)
ANK 193..311 CDD:238125 34/112 (30%)
Ank_2 197..290 CDD:289560 26/94 (28%)
ANK repeat 225..256 CDD:293786 9/30 (30%)
ANK repeat 258..290 CDD:293786 7/33 (21%)
Asb7NP_536691.2 ANK 1 13..42
PHA02875 21..>241 CDD:165206 49/187 (26%)
ANK repeat 46..77 CDD:293786 5/22 (23%)
ANK 2 46..75 4/20 (20%)
ANK 3 80..109 8/28 (29%)
ANK repeat 81..114 CDD:293786 9/32 (28%)
ANK repeat 116..147 CDD:293786 13/30 (43%)
ANK 4 116..145 13/28 (46%)
ANK repeat 149..180 CDD:293786 9/30 (30%)
ANK 5 149..178 9/28 (32%)
ANK 6 180..208 6/31 (19%)
ANK repeat 213..244 CDD:293786 4/12 (33%)
ANK 7 213..242 4/12 (33%)
PTZ00322 219..>272 CDD:140343 2/5 (40%)
SOCS_ASB7 273..317 CDD:239696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.