DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Psmd10

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_446377.1 Gene:Psmd10 / 116722 RGDID:620350 Length:231 Species:Rattus norvegicus


Alignment Length:157 Identity:47/157 - (29%)
Similarity:73/157 - (46%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAV 234
            |...|::.||..|..|:..| .:|.:|||:|...|.....:.||.|.|::.|.:.||.|..|.|.
  Rat    51 GHTEIVEFLLQLGVPVNEKD-DAGWSPLHIAASAGRDEIVKALLIKGAQVNAVNQNGCTALHYAA 114

  Fly   235 DANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDL 299
            ..|:.||....||.|||.:|::....|.:.||.. ..:::::.:|:.:.|.....|..|.|...|
  Rat   115 SKNRHEIAVMLLEGGANPDAKNHYDATAMHRAAA-KGNLKMVHILLFYKASTNIQDTEGNTPLHL 178

  Fly   300 ---------AKLYHRQEAKDYFDEVQK 317
                     |||...|.|..|.:..::
  Rat   179 ACDEERVEEAKLLVTQGASIYIENKEE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 26/73 (36%)
ANK repeat 128..156 CDD:293786
Ank_2 129..223 CDD:289560 18/52 (35%)
ANK repeat 158..189 CDD:293786 6/18 (33%)
ANK repeat 192..223 CDD:293786 11/30 (37%)
ANK 193..311 CDD:238125 39/126 (31%)
Ank_2 197..290 CDD:289560 28/92 (30%)
ANK repeat 225..256 CDD:293786 14/30 (47%)
ANK repeat 258..290 CDD:293786 5/31 (16%)
Psmd10NP_446377.1 ANK 1 3..36
Ank_4 13..60 CDD:290365 2/8 (25%)
ANK 36..159 CDD:238125 35/109 (32%)
ANK 2 37..69 6/17 (35%)
ANK repeat 39..70 CDD:293786 6/18 (33%)
Ank_2 44..136 CDD:289560 32/85 (38%)
ANK 3 70..102 11/32 (34%)
ANK repeat 72..103 CDD:293786 11/30 (37%)
ANK 4 103..135 13/31 (42%)
ANK repeat 105..136 CDD:293786 14/30 (47%)
Ank_2 110..202 CDD:289560 26/92 (28%)
ANK 5 136..168 5/32 (16%)
ANK repeat 138..169 CDD:293786 5/31 (16%)
ANK 6 169..201 10/31 (32%)
Ank 171..203 CDD:278452 9/31 (29%)
ANK repeat 171..202 CDD:293786 9/30 (30%)
ANK 7 202..226 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.