DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and Ankrd1

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_038496.2 Gene:Ankrd1 / 107765 MGIID:1097717 Length:319 Species:Mus musculus


Alignment Length:165 Identity:52/165 - (31%)
Similarity:83/165 - (50%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSNGM 227
            |..|.::|.:.|::.|:.||..:...|.... |.:|.|...|:....::||||.|::.|.|....
Mouse   157 LHRACLEGHLAIVEKLMEAGAQIEFRDMLES-TAIHWACRGGNADVLKLLLNKGAKISARDKLLS 220

  Fly   228 TPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGV 292
            |..|.||.....|..:..:...|:..|:|..|.|.|..||.:| ..::|::|:|.||||...:..
Mouse   221 TALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLN-RYKMIRLLMTFGADLKVKNCA 284

  Fly   293 GKTCTDLAKLYHRQEAKDYFDEVQKFRLEKS-VAT 326
            |||..||. |:.:...|..||.:::...:.| :||
Mouse   285 GKTPMDLV-LHWQSGTKAIFDSLKENAYKNSRIAT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 24/80 (30%)
ANK repeat 128..156 CDD:293786
Ank_2 129..223 CDD:289560 18/59 (31%)
ANK repeat 158..189 CDD:293786 7/25 (28%)
ANK repeat 192..223 CDD:293786 10/30 (33%)
ANK 193..311 CDD:238125 39/117 (33%)
Ank_2 197..290 CDD:289560 31/92 (34%)
ANK repeat 225..256 CDD:293786 7/30 (23%)
ANK repeat 258..290 CDD:293786 13/31 (42%)
Ankrd1NP_038496.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..65
Ank_4 126..172 CDD:290365 4/14 (29%)
ANK 147..272 CDD:238125 34/116 (29%)
ANK 1 152..181 7/23 (30%)
ANK repeat 154..183 CDD:293786 7/25 (28%)
Ank_2 157..249 CDD:289560 26/92 (28%)
ANK 2 185..214 9/29 (31%)
ANK repeat 188..216 CDD:293786 10/27 (37%)
ANK repeat 218..249 CDD:293786 7/30 (23%)
ANK 3 218..247 6/28 (21%)
Ank_2 223..>295 CDD:289560 26/73 (36%)
ANK repeat 251..282 CDD:293786 13/31 (42%)
ANK 4 251..280 13/29 (45%)
ANK 5 284..315 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.