DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and ankrd2

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_021336623.1 Gene:ankrd2 / 101886079 ZFINID:ZDB-GENE-090313-383 Length:303 Species:Danio rerio


Alignment Length:256 Identity:66/256 - (25%)
Similarity:105/256 - (41%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NLEENFGYRLRIK-ALTVSKDGHCYVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFLVKRMLR 146
            |:.|....:.:|| ..|:||| ...|..|:.||.....||             :|:..:|:|.| 
Zfish    79 NIIELCTQKKKIKNKTTLSKD-ITNVSGAVEPEEFLKAAA-------------QGKMEVVERFL- 128

  Fly   147 RRPSLMEYPASNGFLP----------LANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAF 201
                      .:|..|          |..|.:|....|::.||..|..::..| ..|...:|.|.
Zfish   129 ----------DDGGDPNTCDEFRKTALHRAALQNHTKIVEKLLDKGADINFKD-RLGCRAVHWAC 182

  Fly   202 YYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRA 266
            ..|.|.:..:|.::.|.:...|....:|.|.|......::|:..|::|.|..|:|..|.|:|..|
Zfish   183 RGGSLSALTVLQDRGADINVRDKLLSSPLHVATRTGHSDVVQHLLDSGININAKDWEGDTVLHDA 247

  Fly   267 VVMNASMELIKVLVTHGADLAALDGVGKTCTDLAKLYHRQEAKDYFDEVQKFRLEKSVATA 327
            |..| ..:::|.|:..|||:...:..|.|.|:..|    |...|..:.::|....|.|..|
Zfish   248 VRFN-RYKIVKQLILAGADMQIKNAEGITATEQVK----QWQFDTKETLEKLEQMKEVGLA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 4/15 (27%)
ANK 128..244 CDD:238125 26/125 (21%)
ANK repeat 128..156 CDD:293786 4/27 (15%)
Ank_2 129..223 CDD:289560 21/103 (20%)
ANK repeat 158..189 CDD:293786 9/40 (23%)
ANK repeat 192..223 CDD:293786 7/30 (23%)
ANK 193..311 CDD:238125 33/117 (28%)
Ank_2 197..290 CDD:289560 27/92 (29%)
ANK repeat 225..256 CDD:293786 8/30 (27%)
ANK repeat 258..290 CDD:293786 11/31 (35%)
ankrd2XP_021336623.1 ANK 135..260 CDD:238125 32/126 (25%)
ANK repeat 143..171 CDD:293786 7/27 (26%)
ANK repeat 174..204 CDD:293786 7/29 (24%)
ANK repeat 206..237 CDD:293786 8/30 (27%)
ANK repeat 239..270 CDD:293786 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.