DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9766 and ppp1r27

DIOPT Version :9

Sequence 1:	NP_001097672.1	Gene:	CG9766 / 40539	FlyBaseID:	FBgn0037229	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	XP_002937360.1	Gene:	ppp1r27 / 100487509	XenbaseID:	XB-GENE-955186	Length:	141	Species:	Xenopus tropicalis

Alignment Length:	118	Identity:	38/118 - (32%)
Similarity:	62/118 - (52%)	Gaps:	3/118 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   133 IRKGQQFLVKRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPL 197
            ||:|....|.|.:|.|...|:....:|...|..|::.|.:..:.||:..|..:...|. :|.|||
Frog    25 IRQGDLEQVGRFIRARKVTMDTIYLSGMAALHEAVLSGNLECVKLLVKYGADIDQRDE-NGWTPL 88

  Fly   198 HLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVK-FALEAG 249
            |:|...|:...||.||:..|:.:|.:|:|..| :..:|::..|::| |..|.|
Frog    89 HMACSDGYPHIARYLLSLGAQSDAVNSDGEKP-YQLIDSDCEELLKLFPPEGG 140

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9766	NP_001097672.1	FN3	35..98	CDD:214495
		ANK	128..244	CDD:238125	35/111 (32%)
		ANK repeat	128..156	CDD:293786	8/22 (36%)
		Ank_2	129..223	CDD:289560	29/89 (33%)
		ANK repeat	158..189	CDD:293786	7/30 (23%)
		ANK repeat	192..223	CDD:293786	13/30 (43%)
		ANK	193..311	CDD:238125	22/58 (38%)
		Ank_2	197..290	CDD:289560	19/54 (35%)
		ANK repeat	225..256	CDD:293786	8/26 (31%)
		ANK repeat	258..290	CDD:293786
ppp1r27	XP_002937360.1	PHA02884	<12..>91	CDD:165212	21/66 (32%)
		ANK repeat	54..81	CDD:293786	6/26 (23%)
		Ank_2	55..134	CDD:372319	25/80 (31%)
		ANK repeat	83..114	CDD:293786	13/30 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1514637at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010