DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and ppp1r27a

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002661302.2 Gene:ppp1r27a / 100332066 ZFINID:ZDB-GENE-131121-348 Length:226 Species:Danio rerio


Alignment Length:238 Identity:58/238 - (24%)
Similarity:99/238 - (41%) Gaps:27/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EYKLLWPDFVSRISNPTVNS----VQLHWSLLK-NASVYCIDKF-----HKRLGWLQLDWTSSSP 78
            :|...:|  ||:.:.|...|    ...|:|... :.|.|...|:     |.|..:....:|.:..
Zfish     2 KYSYQYP--VSQYTRPHYTSSTQYTPSHYSSSSYSPSYYSSSKYSPTTLHTRKYYTPPAYTPAYK 64

  Fly    79 ITVTNLEENFGYRLRIKALTVSKDGHCYVPLAISPEIVACTAAALPSTH--CLSRAIRKGQQFLV 141
            .|.|:          :.:.|..........:.|:|.:....|.|:..|:  .....:|..:...:
Zfish    65 PTYTS----------VCSKTSRPSSSPRTAVQITPSVTLKPARAVRFTNDVVFQDLVRHSELEQI 119

  Fly   142 KRMLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHL 206
            .|.:|.|...::....:|...|..|::.|.:..:.||:..|..||..|. :|.||||:|...|:.
Zfish   120 GRFMRARKVRLDTIFHSGMAALHEAVLSGSLECVKLLIKYGADVHQRDE-NGWTPLHMACSDGYP 183

  Fly   207 PSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVKFALEAG 249
            ..|:.||:..|.:||.:.||..||. .:|.:..|::|. .|.|
Zfish   184 EIAKYLLSLGASVEAENENGEKPAD-LIDPDCKELLKL-FETG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 12/72 (17%)
ANK 128..244 CDD:238125 33/115 (29%)
ANK repeat 128..156 CDD:293786 4/27 (15%)
Ank_2 129..223 CDD:289560 27/93 (29%)
ANK repeat 158..189 CDD:293786 9/30 (30%)
ANK repeat 192..223 CDD:293786 13/30 (43%)
ANK 193..311 CDD:238125 22/57 (39%)
Ank_2 197..290 CDD:289560 19/53 (36%)
ANK repeat 225..256 CDD:293786 9/25 (36%)
ANK repeat 258..290 CDD:293786
ppp1r27aXP_002661302.2 ANK <135..218 CDD:238125 29/84 (35%)
ANK repeat 136..167 CDD:293786 9/30 (30%)
Ank_4 137..190 CDD:290365 18/53 (34%)
ANK repeat 169..200 CDD:293786 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.