DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and ankrd22

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001106561.1 Gene:ankrd22 / 100127758 XenbaseID:XB-GENE-1003075 Length:191 Species:Xenopus tropicalis


Alignment Length:170 Identity:43/170 - (25%)
Similarity:70/170 - (41%) Gaps:31/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PLANAIIQGEMCIIDLLLSAG-CSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKARLEATDSN 225
            |:..|..:..:..:.|||:.. .:|::.|...|.|||..|...||:..|..||:.||.:..|::.
 Frog     8 PICQAAYENNLEEVQLLLAEDPNNVNVKDNYGGDTPLICACRKGHIQVAGYLLSAKANVNLTNNK 72

  Fly   226 GMTPAHCAV----------------------------DANQLE-IVKFALEAGANAEARDVCGWT 261
            ..|..|.||                            ...|.| ::|..|::|.:..|.|..|.|
 Frog    73 ERTCLHYAVRRRFSFLDYLLIIILMPVLLVGYIIMVSKTKQNERLIKLLLQSGVDPNAADSKGNT 137

  Fly   262 LLMRAVVMNASMELIKVLVTHGADLAALDGVGKTCTDLAK 301
            .|..|..|. |..::.:|:...||....:..|::..|:|:
 Frog   138 ALHYACRMK-SKSVVPLLLDARADPYMKNKDGESPIDIAE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495
ANK 128..244 CDD:238125 26/111 (23%)
ANK repeat 128..156 CDD:293786
Ank_2 129..223 CDD:289560 19/61 (31%)
ANK repeat 158..189 CDD:293786 6/27 (22%)
ANK repeat 192..223 CDD:293786 12/30 (40%)
ANK 193..311 CDD:238125 36/138 (26%)
Ank_2 197..290 CDD:289560 30/121 (25%)
ANK repeat 225..256 CDD:293786 10/59 (17%)
ANK repeat 258..290 CDD:293786 9/31 (29%)
ankrd22NP_001106561.1 ANK repeat 8..36 CDD:293786 6/27 (22%)
Ank_2 15..>187 CDD:393464 41/163 (25%)
ANK repeat 40..70 CDD:293786 12/29 (41%)
ANK repeat 72..132 CDD:293786 10/59 (17%)
ANK repeat 134..165 CDD:293786 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.