DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9766 and fank1

DIOPT Version :9

Sequence 1:NP_001097672.1 Gene:CG9766 / 40539 FlyBaseID:FBgn0037229 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002664080.5 Gene:fank1 / 100005699 ZFINID:ZDB-GENE-130613-3 Length:378 Species:Danio rerio


Alignment Length:273 Identity:69/273 - (25%)
Similarity:120/273 - (43%) Gaps:20/273 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VSRISNPTVNSVQLHWSLLK---------NASVYCIDKFHK-RLGWLQLDWTSSSPITVTNLEEN 87
            |.::|:   :|::|.||..|         |.:.:.:::.:. :..:.|:....::..||.|||..
Zfish    57 VGQVSH---HSIELVWSREKGSKWTDPPQNWTCFILEQMNNTKHSFKQIHKGYNTRFTVDNLEPK 118

  Fly    88 FGYRLRIKALTVSKDGHCYVPLAISPEIVACTAAALPSTHCLSRAIRKGQQFLVKRMLRRRPSLM 152
            ..|..|:|....|.....|      |.:.|.|.....:...|..|:.|..:..:.|:|:.....:
Zfish   119 TTYTFRLKVTWPSGQQQYY------PSVTASTEKPPLNGKNLHSAVLKTDEVELCRVLQSGTVTV 177

  Fly   153 EYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSGRTPLHLAFYYGHLPSARILLNKKA 217
            :.|....:.||..|.|:|....:.:|:..|..|...: .||:..|.||.::|||...::|....|
Zfish   178 DVPDRLDYTPLMMAAIKGFTSGVQILVHHGADVSRKN-SSGKDSLMLACFHGHLDVVKLLCGCGA 241

  Fly   218 RLEATDSNGMTPAHCAVDANQLEIVKFALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTH 282
            ...|.|..|....|.|....||:|:::.::.|.....:|...||.||...|:.....:..:|::.
Zfish   242 SWRARDRTGCCSLHWATAGGQLDILQYLIQYGCEVNVQDNIAWTPLMIVSVITGDPAVASLLISA 306

  Fly   283 GADLAALDGVGKT 295
            |||:...|..|||
Zfish   307 GADVNVQDRDGKT 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9766NP_001097672.1 FN3 35..98 CDD:214495 16/72 (22%)
ANK 128..244 CDD:238125 32/115 (28%)
ANK repeat 128..156 CDD:293786 5/27 (19%)
Ank_2 129..223 CDD:289560 25/93 (27%)
ANK repeat 158..189 CDD:293786 8/30 (27%)
ANK repeat 192..223 CDD:293786 11/30 (37%)
ANK 193..311 CDD:238125 32/103 (31%)
Ank_2 197..290 CDD:289560 27/92 (29%)
ANK repeat 225..256 CDD:293786 7/30 (23%)
ANK repeat 258..290 CDD:293786 9/31 (29%)
fank1XP_002664080.5 FN3 53..144 CDD:238020 21/95 (22%)
ANK 154..270 CDD:238125 32/116 (28%)
ANK repeat 154..181 CDD:293786 5/26 (19%)
ANK repeat 186..214 CDD:293786 8/27 (30%)
ANK 213..337 CDD:238125 33/108 (31%)
ANK repeat 216..247 CDD:293786 11/30 (37%)
ANK repeat 254..280 CDD:293786 6/25 (24%)
ANK repeat 282..314 CDD:293786 9/31 (29%)
ANK 311..>369 CDD:238125 4/9 (44%)
ANK repeat 316..347 CDD:293786 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BKQB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50214
OrthoDB 1 1.010 - - D1514637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.