DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and STOML1

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_004800.2 Gene:STOML1 / 9399 HGNCID:14560 Length:398 Species:Homo sapiens


Alignment Length:256 Identity:71/256 - (27%)
Similarity:124/256 - (48%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QSSSVNVFHDES--LLPQR-NVKTSENVP---PTC-AEKTLFVLSMILIVLCLPWSLFCCLRVMS 70
            |.||......:.  |.|:| .|.|..:||   |:| ....:..|..:|:::..|.|.:..|:::.
Human    19 QQSSFGFLGSQKGCLSPERGGVGTGADVPQSWPSCLCHGLISFLGFLLLLVTFPISGWFALKIVP 83

  Fly    71 EYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVY 135
            .|||.::.||||:|  .|:|||::.|:|.||....||:|||:|::...::.::|...:|:...|.
Human    84 TYERMIVFRLGRIR--TPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQ 146

  Fly   136 YSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIR 200
            :.|..|..:::.|.|...||...|...:........|.::...|..:|:|:...:.:.|..||:.
Human   147 FRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRAWGLE 211

  Fly   201 VERVE--IKEIFMPDQLKRA-----LAVEQEAMR------EAKAKVAAAQGERDAVTALKE 248
            |:|||  ::.:..|.|...|     ..::|.|:.      .:.|..|.:.|..|.|..:.|
Human   212 VDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMAGGAPSPGPADTVEMVSE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 47/165 (28%)
SPFH_like 89..292 CDD:302763 45/173 (26%)
STOML1NP_004800.2 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000255, ECO:0000269|PubMed:19696025 6..10
PHB 77..217 CDD:214581 43/141 (30%)
SPFH_SLP-1 94..224 CDD:259814 38/131 (29%)
SCP2 304..395 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.