DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and PHB2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_011747.2 Gene:PHB2 / 853146 SGDID:S000003463 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:47/213 - (22%)
Similarity:78/213 - (36%) Gaps:52/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GVIFLVPCIDDLAVVDIR---------TRSFDLHRQEILTR-----DMVTISIDGVVYYSIKSPF 142
            |..|:.|.:|...:.|:|         |.:.||....|..|     |:|.:.   .:|.::...:
Yeast    84 GTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDLQMVNITCRVLSRPDVVQLP---TIYRTLGQDY 145

  Fly   143 DAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVE----- 202
            |        |.....:....|:.|........|::.:|.:|..|...|......:.|.::     
Yeast   146 D--------ERVLPSIVNEVLKAVVAQFNASQLITQREKVSRLIRENLVRRASKFNILLDDVSIT 202

  Fly   203 ----------RVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGERDAV----TALKEAADIM 253
                      .||.|:|...| .:||..|..:|.:|.:..|..||||..:.    .|:|::.|.:
Yeast   203 YMTFSPEFTNAVEAKQIAQQD-AQRAAFVVDKARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYV 266

  Fly   254 ETNPIALQLRYLQTLNSI 271
            |       |:.|.|...|
Yeast   267 E-------LKRLDTARDI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 32/159 (20%)
SPFH_like 89..292 CDD:302763 47/213 (22%)
PHB2NP_011747.2 SPFH_prohibitin 58..252 CDD:259799 39/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.