DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and PHB1

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_011648.3 Gene:PHB1 / 853033 SGDID:S000003364 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:47/232 - (20%)
Similarity:87/232 - (37%) Gaps:68/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GPGVIFLVPCIDDLAVVDIRTRSFD-------------------LHRQEILTRDMVTISIDGVVY 135
            |.|..||||.:....:.|:||:...                   |||.|:|...        .:|
Yeast    53 GEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLP--------AIY 109

  Fly   136 YSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIR 200
            .::...:|        |.....:....|:::.......:|::.:|.:|.:|...|......:||:
Yeast   110 QNLGLDYD--------ERVLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIK 166

  Fly   201 VERVEI---------------KEIFMPDQLKRALAVEQEAMREAKAKVAAAQGERDA-------- 242
            :|.|.|               |:|...| .:||..:.::|.:|.:|.|..|:||.::        
Yeast   167 LEDVSITHMTFGPEFTKAVEQKQIAQQD-AERAKFLVEKAEQERQASVIRAEGEAESAEFISKAL 230

  Fly   243 ---------VTALKEAADIMETNPIALQLRYLQTLNS 270
                     :..|:.:.||.:|...:..:.||.:.:|
Yeast   231 AKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQHS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 33/166 (20%)
SPFH_like 89..292 CDD:302763 47/232 (20%)
PHB1NP_011648.3 SPFH_prohibitin 29..223 CDD:259799 40/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.