DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and Stoml2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_075720.1 Gene:Stoml2 / 66592 MGIID:1913842 Length:353 Species:Mus musculus


Alignment Length:236 Identity:71/236 - (30%)
Similarity:118/236 - (50%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLLPQRNVKTSENVPPTCAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPP 88
            :||.:.:|:.|..||...:..    |....::|.:|           :.|..|:.|:||..    
Mouse    11 ALLLRGSVQASGRVPRRASSG----LPRNTVILFVP-----------QQEAWVVERMGRFH---- 56

  Fly    89 R--GPGVIFLVPCIDDLAVV-DIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYD 150
            |  .||:..|:|.:|.:..| .::....::..|..:|.|.||:.||||:|..|..|:.|...|.|
Mouse    57 RILEPGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVED 121

  Fly   151 PEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQL 215
            ||.|..:||.||:|:..|...|..:...:|.|:..|...:..:.:.||||..|.|||:|.:|.::
Mouse   122 PEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEIKDIHVPPRV 186

  Fly   216 KRALAVEQEAMREAKAKVAAAQGERDA---VTALKEAADIM 253
            |.::.::.||.|..:|.|..::|.|::   |...|:.|.|:
Mouse   187 KESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQIL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 51/161 (32%)
SPFH_like 89..292 CDD:302763 57/171 (33%)
Stoml2NP_075720.1 HflC 38..314 CDD:223407 64/205 (31%)
SPFH_paraslipin 74..184 CDD:259811 38/109 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.