DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and stoml1

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001103502.1 Gene:stoml1 / 563294 ZFINID:ZDB-GENE-070209-241 Length:410 Species:Danio rerio


Alignment Length:294 Identity:80/294 - (27%)
Similarity:132/294 - (44%) Gaps:51/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TPALLAQSSSVNVFHDE------SLLPQRNVKTSENVPPTCAEKTLFVLSMI--LIVLCL----- 58
            ||.|.:..|..|..|.:      ..:|    |..:|   ...:|:..:||.:  |||..|     
Zfish    25 TPGLFSSHSPFNNSHHDHRGHSFDYVP----KVHQN---DYTDKSQGLLSWLCNLIVTFLVFLFT 82

  Fly    59 ----PWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRTRSFDLHRQE 119
                |.|.:..|:|:..|||.|:.||||:|  ||:||||:.::|.||....||:|||:|::...:
Zfish    83 FVTFPISGWFVLKVVPNYERVVVFRLGRIR--PPKGPGVVLILPFIDQWQRVDLRTRAFNIPPCK 145

  Fly   120 ILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSN 184
            :.|:|...:|:...:.:.|.||..:::.|.|...:|...|...:........|.::.:.:..|..
Zfish   146 VCTKDSGLVSVGADIQFRIWSPVMSVVAVQDLNSSTRLTAQNAMMTSLSKKSLREIQTDRLKLGE 210

  Fly   185 QIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGERDAVTALKEA 249
            .:...:...|:|||:.|:|||:              :.:..:||       ..|.......:..:
Zfish   211 HLGMDMNEMTKPWGLEVDRVEL--------------ILEGVVRE-------PDGGHSGPLIMPPS 254

  Fly   250 ADIME--TNPI-ALQLRYL-QTLNSICNDDTRSY 279
            ...:|  |.|| .|.:.:| ||..|.|..||.|:
Zfish   255 VPGLEGLTGPIQQLAMHFLSQTTASQCTQDTVSF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 46/158 (29%)
SPFH_like 89..292 CDD:302763 49/195 (25%)
stoml1NP_001103502.1 PHB 94..232 CDD:214581 45/139 (32%)
SPFH_SLP-1 109..239 CDD:259814 38/145 (26%)
SCP2 301..405 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.