DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and stoml3b

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001017825.1 Gene:stoml3b / 550523 ZFINID:ZDB-GENE-050417-366 Length:278 Species:Danio rerio


Alignment Length:253 Identity:120/253 - (47%)
Similarity:176/253 - (69%) Gaps:0/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAV 105
            |....|.::|....:|..|.|:|..::::.|||||||.||||:..:..:|||:.|::||.|....
Zfish    25 CCGWILVIISAFFSILVFPISVFISIKIVKEYERAVIFRLGRITARKAKGPGIFFIIPCTDSFIK 89

  Fly   106 VDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTH 170
            ||:||.|||:..|||||:|.||:|:|||||:.:..|..::..|.:.:.:|..||.||||||.||.
Zfish    90 VDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVNDPVASVANVSNADYSTRLLAQTTLRNVLGTK 154

  Fly   171 KLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAA 235
            .|.::||.:|.:|:.::..|..:|:.|||:|||||||::.:|.||:||:|.|.||.|||:|||.|
Zfish   155 NLAEVLSDREGISHSMQTTLDEATDSWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIA 219

  Fly   236 AQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIVRNLMK 293
            |:||.:|..|||||:.::..:|.|||||||||||:|..:...:.|||.|:||:.:.::
Zfish   220 AEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIVFPLPIDIMNHFIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 75/158 (47%)
SPFH_like 89..292 CDD:302763 102/202 (50%)
stoml3bNP_001017825.1 PHB 49..200 CDD:214581 71/150 (47%)
SPFH_like 72..270 CDD:302763 100/197 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.