DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and zgc:112408

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001017597.1 Gene:zgc:112408 / 550260 ZFINID:ZDB-GENE-050417-63 Length:291 Species:Danio rerio


Alignment Length:248 Identity:117/248 - (47%)
Similarity:173/248 - (69%) Gaps:1/248 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRT 110
            |...|.:||....|.|::.|::|:.|||||||.|||||. ...:|||:.:::||:|....||:||
Zfish    44 LTFFSCLLIFFTFPVSVWFCMKVVQEYERAVIFRLGRLL-GGAKGPGLFWIIPCMDTFRKVDLRT 107

  Fly   111 RSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDL 175
            .|||:..||:||:|.||..:|.||||.|.:|..::.:|.:...||:.:|.|||||:.||..|.|:
Zfish   108 VSFDIPAQEVLTKDSVTTMVDAVVYYRIFNPTVSITKVENANYATQMIAQTTLRNMLGTKSLADI 172

  Fly   176 LSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGER 240
            |..:|.:|.|:|.:||::::.|||:|||||:|::.:|..|:||:|.|.||.|:|:|||.||:||.
Zfish   173 LKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIAAEGEM 237

  Fly   241 DAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIVRNLMK 293
            .|..||||||::|..:|.||||||:|||..|.::...:.:||.|:|::...|:
Zfish   238 KASRALKEAANVMSESPAALQLRYMQTLTEIASERNSTIIFPVPMDLMSGFMR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 75/158 (47%)
SPFH_like 89..292 CDD:302763 96/202 (48%)
zgc:112408NP_001017597.1 HflC 44..290 CDD:223407 116/246 (47%)
SPFH_like 83..283 CDD:302763 95/199 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.