DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and l(2)37Cc

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster


Alignment Length:210 Identity:40/210 - (19%)
Similarity:89/210 - (42%) Gaps:27/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GPGVIFLVPCIDDLAVVDIRTRSFDLHRQEILT--RDMVTISIDGVVYY-----SIKSPFDAMLQ 147
            |.|..|.:|.:....:.|||::..::   .::|  :|:..::|...:.|     .:...:..:.|
  Fly    51 GEGTHFFIPWVQRPIIFDIRSQPRNV---PVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQ 112

  Fly   148 VYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMP 212
            .|| |.....:|...|:.|.......:|::.:|.:|.::...|....:.:|..::.:.:..:...
  Fly   113 DYD-ERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFG 176

  Fly   213 DQLKRALAVEQEAMREAK--------------AKVAAAQGERDAVTALKEAADIMETNPIALQLR 263
            .:...|:.::|.|.:||:              |.:.:|:|:.:|...|  |....|.....::||
  Fly   177 REFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLL--AKSFGEAGDGLVELR 239

  Fly   264 YLQTLNSICNDDTRS 278
            .::....|....:||
  Fly   240 RIEAAEDIAYQLSRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 24/139 (17%)
SPFH_like 89..292 CDD:302763 40/210 (19%)
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 31/173 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.