DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and stoml2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001004808.1 Gene:stoml2 / 448051 XenbaseID:XB-GENE-1017042 Length:350 Species:Xenopus tropicalis


Alignment Length:229 Identity:67/229 - (29%)
Similarity:114/229 - (49%) Gaps:20/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPR--GPGVIFLVPCIDDLAVV-DIRT 110
            |.|..:||.:|           :.|..||.|:||..    |  .||:..|:|.:|.:..| .::.
 Frog    36 LPMNTVVLFVP-----------QQEAWVIERMGRFH----RILEPGLNVLIPILDRIRYVQSLKE 85

  Fly   111 RSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDL 175
            ...::..|..::.|.||:.||||:|..|..|:.|...|.|||.|..:||.||:|:..|...|..:
 Frog    86 IVINVPEQSAVSLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLTLDKV 150

  Fly   176 LSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGER 240
            ...:|.|:..|...:..:::.|||:..|.|||:|.:|.::|.|:.::.||.|..:|.|..::|.|
 Frog   151 FRERESLNANIVDAINQASDYWGIKCLRYEIKDIHVPPKVKEAMQMQVEAERRKRAMVLESEGTR 215

  Fly   241 DAVTALKEAADIMETNPIALQLRYLQTLNSICND 274
            :  :|:..|....:...:|.:....:.:|....:
 Frog   216 E--SAINVAEGQKQAQILASEAERAEQINKAAGE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 51/161 (32%)
SPFH_like 89..292 CDD:302763 56/189 (30%)
stoml2NP_001004808.1 HflC 45..318 CDD:223407 63/220 (29%)
SPFH_paraslipin 78..188 CDD:259811 36/109 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.