DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and phb2b

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001002681.2 Gene:phb2b / 436954 ZFINID:ZDB-GENE-040718-430 Length:303 Species:Danio rerio


Alignment Length:249 Identity:56/249 - (22%)
Similarity:100/249 - (40%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ERAVIL-RLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRTR---------SFDLHRQEI----LTR 123
            :||:|. |:|.::.......|:.|.:|......:.|||.|         |.||....|    |:|
Zfish    55 QRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSR 119

  Fly   124 DMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEG 188
            .:.:         ::...:..:.|.|| |.....:....|::|........|::.:..:|..|..
Zfish   120 PLAS---------NLPIMYQQLGQDYD-ERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRR 174

  Fly   189 ILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREA--------------KAKVAAAQGE 239
            .|:...:.:.|.::.|.|.|:....:...|:..:|.|.:||              |.|:..|:||
Zfish   175 ELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGE 239

  Fly   240 RDAVTALKEAADIMETNPIALQLRYLQTLNSICND--DTRSYVFPFPVDIVRNL 291
            ..|...|.||   :..||..|:||.::...:|...  .:::.|:.....:|.||
Zfish   240 AQAAKMLGEA---VTKNPGYLKLRRIRAAQNIAKTVAASQNKVYLSADSLVMNL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 33/163 (20%)
SPFH_like 89..292 CDD:302763 51/232 (22%)
phb2bNP_001002681.2 SPFH_prohibitin 49..243 CDD:259799 42/197 (21%)
PHB 49..209 CDD:214581 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.