DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and stoml3

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_989344.1 Gene:stoml3 / 394970 XenbaseID:XB-GENE-1015871 Length:283 Species:Xenopus tropicalis


Alignment Length:247 Identity:111/247 - (44%)
Similarity:178/247 - (72%) Gaps:0/247 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRT 110
            :.:||..:..:..|.|::.|::::.||||||:.||||:.....:||||:|::||.|....||:|.
 Frog    34 ILILSAFMAAITFPLSIWFCVKIIQEYERAVVFRLGRIISGKAKGPGVMFVLPCTDTFIKVDLRV 98

  Fly   111 RSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDL 175
            .||.:..|||||:|.||.::||||||:|:|...|:..|.:...||::||.|||||:.||..|.::
 Frog    99 ISFAIPPQEILTKDSVTTTVDGVVYYNIQSAIKAVANVNNVHIATQQLAQTTLRNILGTQTLANI 163

  Fly   176 LSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGER 240
            |:::|.:::.|:.||.::|..||::|:|||::::.:|.|::||:|.|.||.|||:|||.||:||.
 Frog   164 LANREEIAHNIQSILDHATHKWGVKVDRVEMRDVRLPVQMQRAMAAEAEAAREARAKVVAAEGEM 228

  Fly   241 DAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIVRNLM 292
            :|..|||||:.::..:|.|||||||||||:|..::..:.|||.|:::::..:
 Frog   229 NASRALKEASLVIAESPAALQLRYLQTLNTIAAENNSTIVFPLPIELMQGFL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 71/158 (45%)
SPFH_like 89..292 CDD:302763 96/202 (48%)
stoml3NP_989344.1 SPFH_like 73..274 CDD:418525 96/200 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.